UniProt UniProt http://www.uniprot.org Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. J. Biol. Chem. (0021-9258) 2004 imex curation Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology brian.hemming@fmi.ch 14-DEC-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology brian.hemming@fmi.ch Accepted 2006-SEP-13 by ORCHARD. 14-DEC-2006: Contacted by JYOTI. Returned mail. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. J. Biol. Chem. (0021-9258) 2004 imex curation Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology brian.hemming@fmi.ch 14-DEC-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology GST-fused MOBK1B was added to bacterial expressed SHP-fused STK38L and autophosphorylation assays were performed using phosphospecific antibodies. brian.hemming@fmi.ch Accepted 2006-SEP-13 by ORCHARD. 14-DEC-2006: Contacted by JYOTI. Returned mail. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein. J. Biol. Chem. (0021-9258) 2004 imex curation Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology brian.hemming@fmi.ch 14-DEC-2006: Contacted by JYOTI. Returned mail. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bichsel SJ., Tamaskovic R., Stegert MR., Hemmings BA. BioCreative - Critical Assessment of Information Extraction systems in Biology brian.hemming@fmi.ch Accepted 2006-SEP-13 by ORCHARD. 14-DEC-2006: Contacted by JYOTI. Returned mail. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation st38l_human Serine/threonine-protein kinase 38-like NDR2 protein kinase Nuclear Dbf2-related kinase 2 STK38L KIAA0965 NDR2 protein protein human Homo sapiens Human MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL 71347E80BC3ADCB3 mob1a_human MOB kinase activator 1A MOB1A C2orf6 MOB4B MOBK1B MOBKL1B Mob1 alpha Mob1 homolog 1B Mps one binder kinase activator-like 1B protein protein human Homo sapiens Human MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR DIP protein Q9H8S9 original sequence version: 107 58043AECAD1F5987 stk38_human Serine/threonine-protein kinase 38 NDR1 STK38 NDR1 protein kinase Nuclear Dbf2-related kinase 1 protein protein human Homo sapiens Human MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK 7262221DBFFAF83C stk38-mobk1b-1 3 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 6 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q15208:p.Arg41Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:59:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg41ala' Tue Jun 30 18:31:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg41Ala' Q15208:p.Tyr31Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:38:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr31ala' Tue Jun 30 19:00:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr31Ala' Q15208:p.Thr74Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:25:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr74ala' Tue Jun 30 18:18:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr74Ala' Q15208:p.Arg78Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 19:36:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg78ala' Tue Jun 30 19:37:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg78Ala' Q15208:p.Lys24Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:58:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys24ala' Tue Jun 30 18:51:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys24Ala' Q15208:p.Arg44Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:59:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg44ala' Tue Jun 30 18:28:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg44Ala' Q15208:p.Leu79Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:38:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu79ala' Tue Jun 30 18:52:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu79Ala' chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association 2A, 2C and 4 In this study, we show that hMOB1, the closest relative of yeast Mob1 and Mob2, stimulates NDR kinase activity and interacts with NDR both in vivo and in vitro. Interaction was increased in OA (okadaic acid) treated cells. Cos1 cells have been transfected with MOBk1B and STK38 and have been treated with OA (okadaic acid) prior to lysis. Alternatively, Cos1 cells have been transfected separately, treated with OA prior to lysis and lysates have neen combined. Interaction heas been observed independent of OA-treatment of STK38/NDR1-transfected cells. Kinase-dead STK38 mutant lys118ala showed interaction in OA-treated cells. mobk1b-stk38-1 3 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association 2B In this study, we show that hMOB1, the closest relative of yeast Mob1 and Mob2, stimulates NDR kinase activity and interacts with NDR both in vivo and in vitro. Interaction was increased in OA (okadaic acid) treated cells. Cos1 cells have been transfected with MOBk1B and STK38 and have been treates with OA (okadaic acid) prior to lysis. stk38l-mobk1b-1 1 4 unspecified role unspecified role prey prey Q9Y2H1:p.Tyr32Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 15:43:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr32ala' Tue Jun 30 19:12:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr32Ala' region SHP (capsid-stabilizing protein of lambdoid phage 21) tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Furthermore, the pull-down assays showed that NDR2 with mutated Tyr-32 does not bind to hMOB1, whereas the binding of NDR2 with mutated Arg-42 and Arg-45 is not abolished (Fig. 5B). 5B stk38l-stk38l-1 2 4 putative self putative self putative self putative self region SHP fusion protein tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true Autophosphorylation of STK38L at sites Thr-75 and Ser-282. Autophosphorylation was stimulated by presence of MOBK1B (UniProt Ac: Q9H8S9) B, GST-hMOB1 or GST was added to bacterially expressed SHP-NDR2, and autophosphorylation reactions were performed for the indicated times. 1B