IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. J. Biol. Chem. (0021-9258) 2004 imex curation Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. Only protein-protein interactions canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu Accepted 2006-MAY-16 by DAVET. 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. J. Biol. Chem. (0021-9258) 2004 imex curation Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu Accepted 2006-MAY-16 by DAVET. 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. J. Biol. Chem. (0021-9258) 2004 imex curation Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu Accepted 2006-MAY-16 by DAVET. 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. J. Biol. Chem. (0021-9258) 2004 imex curation Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Canalicular membrane vesicles (CMV) prepared from rat liver were used. Fig 1 daniel.ortiz@tufts.edu Accepted 2006-MAY-16 by DAVET. 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. J. Biol. Chem. (0021-9258) 2004 imex curation Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu Accepted 2006-MAY-16 by DAVET. 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. Identification of HAX-1 as a protein that binds bile salt export protein and regulates its abundance in the apical membrane of Madin-Darby canine kidney cells. J. Biol. Chem. (0021-9258) 2004 imex curation Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ortiz DF., Moseley J., Calderon G., Swift AL., Li S., Arias IM. BioCreative - Critical Assessment of Information Extraction systems in Biology Fig 1 daniel.ortiz@tufts.edu Accepted 2006-MAY-16 by DAVET. 14-DEC-2006: Contacted by JYOTI. Rat liver cDNA library used. J. Biol. Chem. (0021-9258) 2004 Only protein-protein interactions imex curation q6psm0_rat Mdr1a protein protein rat Rattus norvegicus (Rat) Rat MELEEDLNGRADKNFSKMGKKSKKEKKEKKPAVSVLTMFRYAGWLDRFYMLLGTLAAIIHGIALPLMMLVFGDMTDSFANVGNNRSMSFYNATDIYAKLKDEMTTYAYYYTGIGAGVLIVAYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKELQAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYTIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYEVFSIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKDVQILKGLNLKVKSGQTVALVGNSGCGKSTTVQLLQRLYDPIEGEVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTAGNEIELGNEACESKDGIDNVDMSSKDSGSSLIRRRSTRKSIRGPHDQDGELSTKEALDDDVPPASFWRILKLNSTEWPYFVVGVFCAIINGGLQPAFSIIFSKVVGVFTKNDTPEIQRQNSNLFSLLFLILGIISFITFFLQGFTFGKAGEILTKRLRYMVFKSMLRQDISWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVITQNIANLGTGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQKFETMYAQSLQIPYRNALKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVARELMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKAKVSASHIIRIIEKIPEIDSYSTEGLKPNMLEGNVKFNGVMFNYPTRPNIPVLQGLSLEGKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGTVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSHEEIVKAAKEANIHQFIDSLPEKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGQVKEHGTHQQLLAQKGIYFSMVSVQAGAKRS 754F9496700083E5 o70420_rat protein protein rat Rattus norvegicus (Rat) Rat MWKASAGHAVSITQDDGEADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLKENELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQKDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYAKGFGGKYGVQKDRMDKNASTFEEVVQVPSAYQKTVPIEAVTSKTSNIRANFESLAKEREQEDRRKAEAERAQRMAQERQEQEARRKLEEQARAKKQTPPASPSPQPAEDRPPSSPIYEDTAPLKAEPSYGSSEPEPEYSTEAAGLPEASNQQGLAYTSEPVYETTEVPGHYQAEDDTYDGYESDLGITAIALYDYQAAGDDEISFDPDDVITNIEMIDDGWWRGVCKGRYGLFPANYVELRQ C0DA73F766739F11 abcbb_rat Bile salt export pump Abcb11 Bsep Spgp ATP-binding cassette sub-family B member 11 Sister of P-glycoprotein protein protein rat Rattus norvegicus (Rat) Rat MSDSVILRSVKKFGEENHAFESDGSHNNDKKSRLQDKMKEGDIRVGFFELFRFSSSKDIWLMLMGGVCALLHGMAQPGILIIFGIMTDIFIKYDIERQELEIPGKACVNNTIVWINSSFHQNMTNGTVCGLVDIESEMIKFSGIYAGVGMTVLILGYFQIRLWVITGARQIRRMRKIYFRRIMRMEIGWFDCTSVGELNSRFADDIEKINDAIADQLAHFLQRMSTAMCGLLLGFYRGWKLTLVILAVSPLIGIGAAVIGLSIAKFTELELKAYAKAGSIADEVLSSIRTVAAFGGENKEVERYEKNLVFAQRWGIWKGMVMGFFTGYMWCLIFFCYALAFWYGSTLVLDEEEYTPGTLVQIFLCVILAAMNIGHASSCLEIFSTGCSAATNIFQTIDRQPVIDCMSGDGYKLDRIKGEIEFHNVTFHYPSRPDVKILDNLSMVIKPGETTALVGSSGAGKSTALQLIQRFYDPCEGMVTLDGHDIRSLNIRWLRDQIGIVEQEPVLFSTTIAENIRFGREDATMEDIVQAAKDANAYNFIMALPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEARVQEALNKIQHGHTIISVAHRLSTVRAADVIIGFEHGVAVERGTHEELLERKGVYFMLVTLQSQGDNAHKETSIMGKDATEGGTLERTFSRGSYRDSLRASIRQRSKSQLSLLTHDPPLAVADHKSSYKDSKDNDVLVEEVEPAPVRRILKYNIPEWHYILVGSLSAAINGAVTPIYSLLFSQLLGTFSLLDKEQQRSEIHSMCLFFVILGCVSIFTQFLQGYTFAKSGELLTKRLRKFGFKAMLGQDIGWFDDLRNNPGVLTTRLATDASQVQGATGSQVGMMVNSFTNIIAALLIAFFFSWKLSLIITIFFPFLALSGAVQTKMLTGFASQDKQALEKAGQITSEALSNIRTVAGIGVEGRFIKAFEVELQTSYKTAVRKANIYGLCFAFSQGIAFLANSAAYRYGGYLIAYEGLGFSHVFRVVSSVALSATAVGRTFSYTPSYAKAKISAARFFQLLDRKPPINVYSEAGEKWDNFQGKIDFIDCKFTYPSRPDIQVLNGLSVSVNPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGTVMIDGHDSKKVNIQFLRSNIGIVSQEPVLFDCSIMDNIKYGDNTKEISVERAIAAAKQAQLHDFVMSLPEKYETNVGIQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQTALDKAREGRTCIVIAHRLSTIQNSDIIAVVSQGVVIEKGTHEKLMAQKGAYYKLVITGAPIS 5443F4EF7B9FB1F6 hax1_human HCLS1-associated protein X-1 HAX1 HS1BP1 HS1-associating protein X-1 HS1-binding protein 1 protein protein human Homo sapiens Human MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEEFGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTVTRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR DIP protein O00165 original sequence version: 138 87EEF0C46857704B hax1_rat HCLS1-associated protein X-1 Hax1 Hs1bp1 HS1-associating protein X-1 HS1-binding protein 1 protein protein rat Rattus norvegicus (Rat) Rat MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDEDDEEEEDSGAWGRESYAFDGFHPTEEFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSHSPELPGPESETPGVRLREGQTLRDSMLKYPDSHQPRIFEGVLESHAKPESSKPAPDWGSQGPFHRLDDTWPVSPHSRAREDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEEHRTVVDSEGRRETTVTHQEAHDSSRSDPDPPRSSALDDPFSILDLLLGRWFRSR 0B49E32FF89CD975 mdr3_rat Phosphatidylcholine translocator ABCB4 Pgp3 Pgy2 Abcb4 Mdr2 ATP-binding cassette sub-family B member 4 P-glycoprotein 2 P-glycoprotein 3 Multidrug resistance protein 2 Multidrug resistance protein 3 protein protein rat Rattus norvegicus (Rat) Rat MDLEAARNGTARRLDGDFELGSISNQSREKKKKVNLIGPLTLFRYSDWQDKLFMLLGTAMAIAHGSGLPLMMIVFGEMTDKFVDNAGNFSLPVNFSLSMLNPGRILEEEMTRYAYYYSGLGGGVLLAAYIQVSFWTLAAGRQIRKIRQKFFHAILRQEMGWFDIKGTTELNTRLTDDISKISEGIGDKVGMFFQAIATFFAGFIVGFIRGWKLTLVIMAITAILGLSTAVWAKILSTFSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKKIGIKKAISANISMGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFPNARGAAYVIFDIIDNNPKIDSFSERGHKPDSIKGNLEFSDVHFSYPSRANIKILKGLNLKVKSGQTVALVGNSGCGKSTTVQLLQRLYDPTEGTISIDGQDIRNFNVRCLREFIGVVSQEPVLFSTTIAENIRYGRGNVTMDEIKKAVKEANAYDFIMKLPQKFDTLVGDRGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFEDGVIVEQGSHSELIKKEGIYFRLVNMQTSGSQILSEEFEVELSDEKAAGGVAPNGWKARIFRNSTKKSLKSSRAHQNRLDVETNELDANVPPVSFLKVLRLNKTEWPYFVVGTLCAIANGALQPAFSIILSEMIAIFGPGDDTVKQQKCNMFSLVFLGLGVHSFFTFFLQGFTFGKAGEILTTRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNTANLGTGIIISFIYGWQLTLLLLSVVPFIAVAGIVEMKMLAGNAKRDKKEMEAAGKIATEAIENIRTVVSLTQERKFESMYVEKLHGPYRNSVRKAHIYGITFSISQAFMYFSYAGCFRFGSYLIVNGHMRFKDVILVFSAIVLGAVALGHASSFAPDYAKAKLSAAYLFSLFERQPLIDSYSREGMWPDKFEGSVTFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGTVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAKNIAYGDNSRVVSQDEIVRAAKEANIHPFIETLPQKYETRVGDKGTQLSGGQKQRIAIARALIRQPRVLLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIDNGKVKEHGTHQQLLAQKGIYFSMVNIQAGTQNL D4FB6BE745AF73BF mdr2-hax1-1 2 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait linker domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association mdr2-hax1-2 3 12 unspecified role unspecified role bait bait linker domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey physical association physical association bsep-hax1-1 3 9 unspecified role unspecified role bait bait linker domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey physical association physical association Interaction of HAX-1 with BSEP in yeast. mdr1a-hax1-1 3 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait linker domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association mdr2-hax1-3 5 11 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver 12 unspecified role unspecified role bait bait linker domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association GST-BSEP and GST-MDR2 Fusion Proteins Bind HAX-1 in Rat Liver Homogenates. bsep-hax1-2 5 9 unspecified role unspecified role bait bait linker domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey rat-liver rattus norvegicus liver Rat liver liver physical association physical association GST-BSEP and GST-MDR2 Fusion Proteins Bind HAX-1 in Rat Liver Homogenates. bsep-hax1-3 6 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association overexpressed. Q7TSE9. O70127. HAX-1 co-immunoprecipitates with BSEP, MDR1, and MDR2 from transfected cells and hepatocytes. bsep-hax1-4 6 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association overexpressed. O70127. HAX-1 co-immunoprecipitates with BSEP, MDR1, and MDR2 from transfected cells and hepatocytes. mdr1a-hax1-2 6 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association over-expressed. Q6PSM0. HAX-1 co-immunoprecipitates with BSEP, MDR1, and MDR2 from transfected cells and hepatocytes. bsep-hax1-6 1 9 unspecified role unspecified role neutral component neutral component eyfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role neutral component neutral component colocalization colocalization overexpressed. Q7TSE9. O70127. HAX-1 and BSEP-EYFP co-localize in the apical domain of MDCK II cells. One to 2 days after confluency, cells showed differentiation of apical and lateral membranes. HAX-1 partially co-localized with BSEP-EYFP in the apical membrane; however, most HAX-1 was located immediately below the apical domain, where it partially localized with BSEP-EYFP. In polarized columnar cells, 4-5 days after confluency, BSEP-EYFP was mostly restricted to the apical membrane where it co-localized with HAX-1 bsep-hax1-7 4 11 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association HAX-1 co-immunoprecipitates with BSEP, MDR1, and MDR2 from transfected cells and hepatocytes. mdr1a-hax1-3 4 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association The antibody used recognize both MDR1 and MDR2. Both MDR1a and MDR2 were shown to bind rat HAX-1 in vitro. HAX-1 co-immunoprecipitates with BSEP, MDR1, and MDR2 from transfected cells and hepatocytes. cttn-hax1-8 4 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association HAX-1 associates with cortactin in the apical membrane of hepatocytes. The antibody my not be specific to an isofom of cortactin.