UniProt UniProt http://www.uniprot.org Stable association of 70-kDa heat shock protein induces latent multisite specificity of a unisite-specific endonuclease in yeast mitochondria. Stable association of 70-kDa heat shock protein induces latent multisite specificity of a unisite-specific endonuclease in yeast mitochondria. J. Biol. Chem. (0021-9258) 1999 imex curation Mizumura H., Shibata T., Morishima N. BioCreative - Critical Assessment of Information Extraction systems in Biology Binding reaction was done with SSC1 GST-fusion protein and purified ENS2 protein. morishim@postman.riken.go.jp 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down monoclonal western monoclonal antibody western blot monoclonal western Mizumura H., Shibata T., Morishima N. BioCreative - Critical Assessment of Information Extraction systems in Biology Binding reaction was done with SSC1 GST-fusion protein and purified ENS2 protein. morishim@postman.riken.go.jp Accepted 2006-SEP-14 by DAVET. 14-DEC-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation Stable association of 70-kDa heat shock protein induces latent multisite specificity of a unisite-specific endonuclease in yeast mitochondria. Stable association of 70-kDa heat shock protein induces latent multisite specificity of a unisite-specific endonuclease in yeast mitochondria. J. Biol. Chem. (0021-9258) 1999 imex curation Mizumura H., Shibata T., Morishima N. BioCreative - Critical Assessment of Information Extraction systems in Biology Binding reaction was done with SSC1 GST-fusion protein and purified ENS2 protein. morishim@postman.riken.go.jp 14-DEC-2006: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Mizumura H., Shibata T., Morishima N. BioCreative - Critical Assessment of Information Extraction systems in Biology Binding reaction was done with SSC1 GST-fusion protein and purified ENS2 protein. morishim@postman.riken.go.jp Accepted 2006-SEP-14 by DAVET. 14-DEC-2006: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation ens2_yeasx Endonuclease SceI small subunit ENS2 RF3 Endo.SceI 50 kDa subunit Maturase-like RF3 protein protein protein yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast MKKQNLNSILLMYINYIINYFNNIHKNQLKKDWIMEYEYMYKFLMNNMTCFIKWDNNKILLLLDMYYNVLYNYHKQRTPMSNKRLMNSKNIMDYKLLYTYFYILNKMKMEMDNYNNNNNNISLKYNELLKNIMNNLNYKTSNIETNLSNNFYLMDKYLINKYMKYLDMLNMIPNNYMFNNINYKGKLNIKTVLDLNNNEFYDYLSGLIEGDGYIGPGGITITNHANDVLNTIFINKRIKNSILVEKWMDTLKDNPYFVNAFSINIKTNLAKEKIFTNIYNKLYSDYKINQINNHIPYYNYLKINNKLPIKNIMDIKNNYWLAGFTAADGSFLSSMYNPKDTLLFKNMRPSYVISQVETRKELIYLIQESFDLSISNVKKVGNRKLKDFKLFTRTTDELMKFIYYFDKFLPLHDNKQFNYIKFRFNTFIKSYNWNNRVFGLVLSEYINNIKIDNYDYYYYNKYINMHNARKPKGYIK AE561085E55FDA69 hsp77_yeast Import motor subunit, mitochondrial ENS1 SSC1 YJR045C J1639 mtHSP70 Endonuclease SceI 75 kDa subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MLAAKNILNRSSLSSSFRIATRLQSTKVQGSVIGIDLGTTNSAVAIMEGKVPKIIENAEGSRTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLIGRRFEDAEVQRDIKQVPYKIVKHSNGDAWVEARGQTYSPAQIGGFVLNKMKETAEAYLGKPVKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSDSKVVAVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYLLREIVSRFKTETGIDLENDRMAIQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTAPLVKRTVDPVKKALKDAGLSTSDISEVLLVGGMSRMPKVVETVKSLFGKDPSKAVNPDEAVAIGAAVQGAVLSGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIFSTAAAGQTSVEIRVFQGERELVRDNKLIGNFTLAGIPPAPKGVPQIEVTFDIDADGIINVSARDKATNKDSSITVAGSSGLSENEIEQMVNDAEKFKSQDEARKQAIETANKADQLANDTENSLKEFEGKVDKAEAQKVRDQITSLKELVARVQGGEEVNAEELKTKTEELQTSSMKLFEQLYKNDSNNNNNNNGNNAESGETKQ This sequence has been withdrawn from Uniprot. 1E5672E76FCE24AC 1E5672E76FCE24AC ssc1-ens2-1 1 3 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Interaction between the 50-kDa protein and mtHSP70. SSC1 N-terminal ATP-ase domain was found to be sufficient for the interaction but the exact range was not specified. Has multi-site specific endonuclease activity. 5 ssc1-ens2-2 2 3 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role neutral component neutral component physical association physical association Heterodimer formation of the 50-kDa protein and mtHSP70 in vitro. 2 The elution profile suggested a SSC1:ENS2 dimer. Only the fraction containing the dimer showed endonuclease activity.