IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Interactions of anti-sigma factor antagonists of Mycobacterium tuberculosis in the yeast two-hybrid system. Tuberculosis (Edinb) (1472-9792) 2005 imex curation Parida BK., Douglas T., Nino C., Dhandayuthapani S. Archaea - Interaction dataset based on Archaea proteins The interactions between the proteins were determined by positive growth of yeast in SD plates lacking adenine and histidine and the presence of blue color for α-galactosidase activity. Colonies which did not show blue in SD plates were not considered positive. The α-galactosidase activity was graded as weak (+), strong (++) and very strong (+++) based on the intensity of the blue color of the yeast colonies. dhandayutha@uthscsa.edu 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions myctx Mycobacterium tuberculosis 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Parida BK., Douglas T., Nino C., Dhandayuthapani S. Archaea - Interaction dataset based on Archaea proteins The interactions between the proteins were determined by positive growth of yeast in SD plates lacking adenine and histidine and the presence of blue color for α-galactosidase activity. Colonies which did not show blue in SD plates were not considered positive. The α-galactosidase activity was graded as weak (+), strong (++) and very strong (+++) based on the intensity of the blue color of the yeast colonies. dhandayutha@uthscsa.edu Accepted 2010-MAY-15 by ORCHARD. Tuberculosis (Edinb) (1472-9792) 2005 orchard Only protein-protein interactions imex curation rsfb_myctu Anti-sigma-F factor antagonist RsfB rsfB Anti-anti-sigma F factor RsfB Rv3687c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSAPDSITVTVADHNGVAVLSIGGEIDLITAAALEEAIGEVVADNPTALVIDLSAVEFLGSVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDKTFRLFSTLHDALTGVRGGRIDR 3F748FC41C6CCBB7 rsfa_myctu Anti-sigma-F factor antagonist RsfA rsfA Anti-anti-sigma F factor RsfA MTCY02B10.29c Rv1365c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTKAAAATTAPEPLVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDRAVARIIHACGYGDVLPVHPTTESALSAT BB489351860A0005 opra_myctu Osmosensory protein A OprA Putative SigF antagonist Putative anti-anti-sigma factor Rv0516c Rv0516c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRGEIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALVASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA 9AD77DACE3093650 mtdrp_myctu Multidomain regulatory protein Rv1364c Anti-sigma-F factor Rv1364c Protein-serine/threonine phosphatase Putative multidomain regulator of SigF Serine/threonine-protein kinase MTCY02B10.28c Rv1364c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAAEMDWDKTVGAAEDVRRIFEHIPAILVGLEGPDHRFVAVNAAYRGFSPLLDTVGQPAREVYPELEGQQIYEMLDRVYQTGEPQSGSEWRLQTDYDGSGVEERYFDFVVTPRRRADGSIEGVQLIVDDVTSRVRARQAAEARVEELSERYRNVRDSATVMQQALLAASVPVVPGADIAAEYLVAAEDTAAGGDWFDALALGDRLVLVVGDVVGHGVEAAAVMSQLRTALRMQISAGYTVVEALEAVDRFHKQVPGSKSATMCVGSLDFTSGEFQYCTAGHPPPLLVTADASARYVEPTGAGPLGSGTGFPVRSEVLNIGDAILFYTDGLIERPGRPLEASTAEFADLAASIASGSGGFVLDAPARPIDRLCSDTLELLLRSTGYNDDVTLLAMQRRAPTPPLHITLDATINAARTVRAQLREWLAEIGADHSDIADIVHAISEFVENAVEHGYATDVSKGIVVAAALAGDGNVRASVIDRGQWKDHRDGARGRGRGLAMAEALVSEARIMHGAGGTTATLTHRLSRPARFVTDTMVRRAAFQQTIDSEFVSLVESGRIVVRGDVDSTTAATLDRQIAVESRSGIAPVTIDLSAVTHLGSAGVGALAAACDRARKQGTECVLVAPPGSPAHHVLSLVQLPVVGADTEDIFAQE 51F29AA39D9C8B9F 51F29AA39D9C8B9F sigf_myctu RNA polymerase sigma factor SigF sigF Alternative RNA polymerase sigma factor SigF RNA polymerase sigma-F factor Stress response/stationary phase sigma factor SigF Rv3286c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLAKSLARLRDQLE 7FD4AA6AB64061AB o07728_myctu Anti-sigma factor antagonist Rv1904 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MRTVAIGPGAGPSSTRPSSQPSDLHSGLRAVTECTGSAVVVHVGGDIDASNEVAWQRLVSKSAAIAIAPGPFVIDIRDLDFMGSCAYAVLAQESVRCRRRGVNMRLVSNQPIVARTIAACGLRRLIPLYATVETALAPPPSAH 9D1EBA3501A95176 rsbw_myctu Anti-sigma-F factor RsbW rsbW Anti-sigma-F factor UsfX Regulator of SigF Sigma-F anti-sigma factor RsbW usfX Rv3287c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTDQLEDQTQGGSTVDRSLPGGCMADSDLPTKGRQRGVRAVELNVAARLENLALLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSALPDATLRLVVDPRKDEVVVEASAACDTHDVVAPGSFSWHVLTALADDVQTFHDGRQPDVAGSVFGITLTARRAASSR D1E729A26DFD765E p71937_mycto Anti-sigma factor antagonist MT2716 protein protein mycto Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) MGLITTEPRSSPHPLSPRLVHELGDPHSTLRATTDGSGAALLIHAGGEIDGRNEHLWRQLVTEAAAGVTAPGPLIVDVTGLDFMGCCAFAALADEAQRCRCRGIDLRLVSHQPIVARIAEAGGLSRVLPIYPTVDTALGKGTAGPARC C279BC99E1ABACB7 rv1364-rv1365-1 1 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score + Table 3 rv1904-rv1364-1 1 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association author score author-based confidence author score ++ Table 3 rv1904-rv1365-1 1 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score +++ Table 3 rv2638-rv1365-1 1 3 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score +++ Table 3 rv1365-rv1904-1 1 3 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 3 rv1904-rv1904-1 1 7 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score + Table 3 rv3287-rv1904-1 1 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 3 rv0516-rv2638-1 1 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score +++ Table 3 rv1364-rv2638-1 1 5 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 3 rv1365-rv2638-1 1 9 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score +++ Table 3 rv2638-rv2638-1 1 9 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score +++ Table 3 rv3286-rv2638-1 1 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score +++ Table 3 rv3287-rv2638-1 1 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 3 rv0516-rv3286-1 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score ++ Table 3 rv1364-rv3286-1 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score +++ Table 3 The RpsU and RpsV domains were sufficient to bind to SigF protein but these could not be matched to any identified InterPro domains and details of the constructs were not given in the paper. rv1904-rv3286-1 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score ++ Table 3 rv2638-rv3286-1 1 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score ++ Table 3 rv3286-rv3286-1 1 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score +++ Table 3 rv3287-rv3286-1 1 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score +++ Table 3 rv-1364-rv3287-1 1 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score ++ Table 3 rv1365-rv3287-1 1 8 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score ++ Table 3, Table 4 rv1904-rv3287-1 1 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score ++ Table 3 rv2638-rv3287-1 1 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score ++ Table 3 rv3286-rv3287-1 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score ++ Table 3 rv3287-rv3287-1 1 8 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association author score author-based confidence author score ++ Table 3 rv3687-rv3287-1 1 2 unspecified role unspecified role bait bait P9WGE1:p.Ser61Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:48:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser61ala' Tue Jun 30 18:47:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser61Ala' 8 unspecified role unspecified role prey prey physical association physical association author score author-based confidence author score ++ Table 3, Table 4 rv1364-rv1364-1 1 5 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined pas domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis range range range range 96 93 physical association physical association author score author-based confidence author score + Table 5 The RsbU and RsbW domains of Q11034 interacted with each other but these domains could not be matched to identified domains within InterPro and construct details were not given in the publication.