IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Protein-protein interactions in the subunits of ribonuclease P in the hyperthermophilic archaeon Pyrococcus horikoshii OT3. Protein-protein interactions in the subunits of ribonuclease P in the hyperthermophilic archaeon Pyrococcus horikoshii OT3. Biosci. Biotechnol. Biochem. (0916-8451) 2005 imex curation Kifusa M., Fukuhara H., Hayashi T., Kimura M. Archaea - Interaction dataset based on Archaea proteins mkifusa@agr.kyushu-u.ac.jp 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions pyrho Pyrococcus horikoshii 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kifusa M., Fukuhara H., Hayashi T., Kimura M. Archaea - Interaction dataset based on Archaea proteins mkifusa@agr.kyushu-u.ac.jp Accepted 2010-MAY-15 by ORCHARD. Biosci. Biotechnol. Biochem. (0916-8451) 2005 orchard Only protein-protein interactions imex curation Protein-protein interactions in the subunits of ribonuclease P in the hyperthermophilic archaeon Pyrococcus horikoshii OT3. Protein-protein interactions in the subunits of ribonuclease P in the hyperthermophilic archaeon Pyrococcus horikoshii OT3. Biosci. Biotechnol. Biochem. (0916-8451) 2005 imex curation Kifusa M., Fukuhara H., Hayashi T., Kimura M. Archaea - Interaction dataset based on Archaea proteins mkifusa@agr.kyushu-u.ac.jp 25-Jun-2010: Contacted by JYOTI. orchard Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kifusa M., Fukuhara H., Hayashi T., Kimura M. Archaea - Interaction dataset based on Archaea proteins mkifusa@agr.kyushu-u.ac.jp Accepted 2010-MAY-15 by ORCHARD. 25-Jun-2010: Contacted by JYOTI. Biosci. Biotechnol. Biochem. (0916-8451) 2005 orchard Only protein-protein interactions imex curation rnp3_pyrho Ribonuclease P protein component 3 rnp3 Rpp30 PH1877 protein protein pyrho Pyrococcus horikoshii MVGGGGVKFIEMDIRDKEAYELAKEWFDEVVVSIKFNEEVDKEKLREARKEYGKVAILLSNPKPSLVRDTVQKFKSYLIYVESNDLRVIRYSIEKGVDAIISPWVNRKDPGIDHVLAKLMVKKNVALGFSLRPLLYSNPYERANLLRFMMKAWKLVEKYKVRRFLTSSAQEKWDVRYPRDLISLGVVIGMEIPQAKASISMYPEIILKRLKY 321490D4A2859C24 rnp4_pyrho Ribonuclease P protein component 4 Rpp21 PH1601 rnp4 protein protein pyrho Pyrococcus horikoshii MVDIVKRRDWEKKEKKKIAIERIDTLFTLAERVARYSPDLAKRYVELALEIQKKAKVKIPRKWKRRYCKRCHTFLIPGVNARVRLRTKRMPHVVITCLECGYIMRYPYLREVKQKRKKAT 2AC453B35C964AE6 rnp2_pyrho Ribonuclease P protein component 2 rnp2 Pop5 PH1481 protein protein pyrho Pyrococcus horikoshii MMRKLKTLPPTLRDKNRYIAFEIISDGDFTKDEVKELIWKSSLEVLGETGTAIVKPWLIKFDPNTKTGIVRCDREYVEYLRFALMLVSEFNGKRLIIRTLGVSGTIKRLKRKFLAKYGWK C78C9EF6C5380E53 rnp1_pyrho Ribonuclease P protein component 1 rnp1 Rpp29 PH1771 protein protein pyrho Pyrococcus horikoshii MRRNSKERKNRATRRSQGSYQEIIGRTWIFRGAHRGRVTRRNIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAGDRIWKVPKDVCIFEFEADDGTKIKIPGERLVGRPEMRLKKRWKKW 840FE2A1234FF0AD rnp2-rnp2 1 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 1 rnp3-rnp3 1 3 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 1 rnp1-rnp1 1 6 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 6 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 1 rnp2-rnp4-1 1 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 1 rnp2-rnp3 1 5 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 unspecified role unspecified role prey prey physical association physical association Fig. 1 rnp4-rnp2 1 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Fig. 1 rnp4-rnp1 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 1 rnp1-rnp4 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig. 1 rnp4-rnp2-1 2 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait physical association physical association Fig. 2 rnp3-rnp2-1 2 5 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 unspecified role unspecified role bait bait physical association physical association Fig. 2