IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB. 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB. Mol. Cell. Biol. (0270-7306) 1998 imex curation Arch RH., Thompson CB., Arch RH., Thompson CB. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Arch RH., Thompson CB. Apoptosis - Interactions involving proteins with a function related to apoptosis Mol. Cell. Biol. (0270-7306) 1998 IMEx 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB. 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB. Mol. Cell. Biol. (0270-7306) 1998 imex curation Arch RH., Thompson CB., Arch RH., Thompson CB. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Arch RH., Thompson CB. Apoptosis - Interactions involving proteins with a function related to apoptosis Directed yeast 2 hybrid analysis Mol. Cell. Biol. (0270-7306) 1998 IMEx 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB. 4-1BB and Ox40 are members of a tumor necrosis factor (TNF)-nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB. Mol. Cell. Biol. (0270-7306) 1998 imex curation Arch RH., Thompson CB., Arch RH., Thompson CB. Apoptosis - Interactions involving proteins with a function related to apoptosis Only protein-protein interactions imex curation yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Arch RH., Thompson CB. Apoptosis - Interactions involving proteins with a function related to apoptosis Mol. Cell. Biol. (0270-7306) 1998 IMEx traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 tnr4_mouse Tumor necrosis factor receptor superfamily member 4 OX40L receptor OX40 antigen Tnfrsf4 Ox40 Txgp1 protein protein mouse Mus musculus Mouse MYVWVQQPTALLLLALTLGVTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLGLLAPLTVLLALYLLRKAWRLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI DIP protein P47741 original sequence version: 101 06E7BB4156F0D08E traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein P39429 original sequence version: 90 DIP protein P39429 original sequence version: 130 DIP protein P39429 original sequence version: 135 DIP protein P39429 original sequence version: 166 043B391180365F10 traf1_mouse TNF receptor-associated factor 1 Traf1 protein protein mouse Mus musculus Mouse MASSSAPDENEFQFGCPPAPCQDPSEPRVLCCTACLSENLRDDEDRICPKCRADNLHPVSPGSPLTQEKVHSDVAEAEIMCPFAGVGCSFKGSPQSMQEHEATSQSSHLYLLLAVLKEWKSSPGSNLGSAPMALERNLSELQLQAAVEATGDLEVDCYRAPCCESQEELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSLEQRVVELQQTLAQKDQVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVDTSA ADD7F997169D9AAD tnr9_mouse Tumor necrosis factor receptor superfamily member 9 4-1BB ligand receptor T-cell antigen 4-1BB Tnfrsf9 Cd137 Ila Ly63 protein protein mouse Mus musculus Mouse MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL 93A10D03C60813C4 traf3_mouse TNF receptor-associated factor 3 CD40 receptor-associated factor 1 TRAFAMN Traf3 Craf1 Trafamn RING-type E3 ubiquitin transferase TRAF3 protein protein mouse Mus musculus Mouse MESSKKMDAAGTLQPNPPLKLQPDRGAGSVLVPEQGGYKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP DIP protein Q60803 original sequence version: 127 DIP protein Q60803 original sequence version: 129 DIP protein Q60803 original sequence version: 117 DIP protein Q60803 original sequence version: 121 EC282EFFF84E5A3F ox40-traf2-3 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520015]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 273-273, sequence length 272 [EBI-520015]238-273 physical association physical association 4_1bb-traf2-3 3 8 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520722]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 257-257, sequence length 256 [EBI-520722]214-257 6 unspecified role unspecified role prey prey physical association physical association ox40-traf2-1 1 4 unspecified role unspecified role prey prey traf domain TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520093]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 273-273, sequence length 272 [EBI-520093]238-273 cd28tm CD28 transmembrane domain tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4_1bb-traf2-2 1 8 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520717]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 257-257, sequence length 256 [EBI-520717]214-257 n terminal CD28 transmembrane domain tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 4 unspecified role unspecified role prey prey traf domain TRAF domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1 4_1bb-traf1-2 3 8 unspecified role unspecified role bait bait cytoplasmic domain cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520725]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 257-257, sequence length 256 [EBI-520725]214-257 7 unspecified role unspecified role prey prey physical association physical association ox40-traf3-2 3 5 unspecified role unspecified role bait bait cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520150]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 273-273, sequence length 272 [EBI-520150]238-273 9 unspecified role unspecified role prey prey physical association physical association ox40-traf1-1 3 5 unspecified role unspecified role bait bait cytoplasmic domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520157]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 273-273, sequence length 272 [EBI-520157]238-273 7 unspecified role unspecified role prey prey physical association physical association The authors note that the OX40 protein demonstrated weak but reproducible interaction with TRAF1 ox40-traf2-2 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait P47741:p.Thr256_Ile258delinsAlaAlaAla region containing TRAF2 binding domain mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain TPI AAA Wed May 02 19:17:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr_pro_ile256-258ala_ala_ala' Tue Jun 30 17:36:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr256_Ile258delinsAlaAlaAla' P47741:p.Gln259_Glu261delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain QEE AAA Wed May 02 15:07:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln_glu_glu259-261ala_ala_ala' Tue Jun 30 17:09:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln259_Glu261delinsAlaAlaAla' P47741:p.His262_Asp264delinsAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain HTD AAA Wed May 02 18:09:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_thr_asp262-264ala_ala_ala' Tue Jun 30 20:19:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His262_Asp264delinsAlaAlaAla' region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain physical association physical association Fig. 2 ox40-traf3-3 2 9 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait gln_glu_glu259-261ala_ala_ala region containing TRAF2 binding domain mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain QEE AAA Wed Jul 06 16:43:25 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'thr pro ile' region cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain P47741:p.His262_Asp264delinsAlaAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain HTD AAA Wed May 02 15:22:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his_thr_asp262-264ala_ala_ala' Tue Jun 30 16:23:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His262_Asp264delinsAlaAlaAla' P47741:p.Thr256_Ile258delinsAlaAlaAla mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain TPI AAA Wed May 02 18:34:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr_pro_ile256-258ala_ala_ala' Tue Jun 30 19:42:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr256_Ile258delinsAlaAlaAla' physical association physical association 4_1bb-traf2-1 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region TRAF2 binding domain binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520708]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 257-257, sequence length 256 [EBI-520708]234-257 physical association physical association 4_1bb-traf3-1 2 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait region TRAF3 binding domain binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-520713]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 257-257, sequence length 256 [EBI-520713]246-257 physical association physical association