IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction between the C. elegans cell-death regulators CED-9 and CED-4. Interaction between the C. elegans cell-death regulators CED-9 and CED-4. Nature (0028-0836) 1997 Spector MS., Desnoyers S., Hoeppner DJ., Hengartner MO. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Spector MS., Desnoyers S., Hoeppner DJ., Hengartner MO. Apoptosis - Interactions involving proteins with a function related to apoptosis Nature (0028-0836) 1997 Interaction between the C. elegans cell-death regulators CED-9 and CED-4. Interaction between the C. elegans cell-death regulators CED-9 and CED-4. Nature (0028-0836) 1997 Spector MS., Desnoyers S., Hoeppner DJ., Hengartner MO. Apoptosis - Interactions involving proteins with a function related to apoptosis yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid full dna sequence full identification by DNA sequencing full dna sequence Spector MS., Desnoyers S., Hoeppner DJ., Hengartner MO. Apoptosis - Interactions involving proteins with a function related to apoptosis Nature (0028-0836) 1997 ced4_caeel Cell death protein 4 ced-4 C35D10.9 protein protein caeel Caenorhabditis elegans MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLARVVSDTDDSHSITDFINRVLSRSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTIANGISILEQRLLEIGNNNVSVPERHIPSHFQKFRRSSASEMYPKTTEETVIRPEDFPKFMQLHQKFYDSLKNFACC DIP protein P30429 original sequence version: 124 6BE9893946B79E6C ced9_caeel Apoptosis regulator ced-9 Cell death protein 9 ced-9 T07C4.8 protein protein caeel Caenorhabditis elegans MTRCTADNSLTNPAYRRRTMATGEMKEFLGIKGTEPTDFGINSDAQDLPSPSRQASTRRMSIGESIDGKINDWEEPRLDIEGFVVDYFTHRIRQNGMEWFGAPGLPCGVQPEHEMMRVMGTIFEKKHAENFETFCEQLLAVPRISFSLYQDVVRTVGNAQTDQCPMSYGRLIGLISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEAEKVGRRKQNRRWSMIGAGVTAGAIGIVGVVVCGRMMFSLK DIP protein P41958 original sequence version: 125 DIP protein P41958 original sequence version: 83 7603675E490DD3EB ced4s-ced9-1 2 3 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ced-4 is the shorter isoform. ced4s-ced9-2 2 3 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 4 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ced-4 is the shorter isoform. ced4s-ced9-3 2 4 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 unspecified role unspecified role bait bait bcl2 homology region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ced-4 is the shorter isoform. ced4s-ced9-10 2 4 unspecified role unspecified role prey prey P41958:p.Tyr149Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y N Wed May 02 17:55:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr149asn' Tue Jun 30 17:56:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr149Asn' yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association ced-4 is the shorter isoform. ced4s-ced9-7 1 3 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) physical association physical association ced-4 protein is the short isoform ced4s-ced9-8 1 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecobb Escherichia coli (strain B / BL21) 3 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) physical association physical association ced-4 protein is the long isoform ced4s-ced9-9 1 3 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range bcl2 homology region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) physical association physical association ced-4 protein is the short isoform