IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. Mol. Cell. Biol. (0270-7306) 1993 Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C human-jurkat Homo sapiens jurkat Human T cell leukemia comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel antibody detection identification by antibody antibody detection Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1993 A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. Mol. Cell. Biol. (0270-7306) 1993 Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1993 A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. A novel NF-kappa B complex containing p65 homodimers: implications for transcriptional control at the level of subunit dimerization. Mol. Cell. Biol. (0270-7306) 1993 Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel antibody detection identification by antibody antibody detection Ganchi PA., Sun SC., Greene WC., Ballard DW. Apoptosis - Interactions involving proteins with a function related to apoptosis Complexes treated with anti-p65 prior to electrophoresis. This caused a shift in migration due to antibody binding. Deoxycholate added to samples to dissociate I-kappaB. 32P-labelled DNA added to reaction mixture and gels visulaised by autoradiography. 1B & 1C Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell. Biol. (0270-7306) 1993 ikka_human Inhibitor of nuclear factor kappa-B kinase subunit alpha CHUK IKKA TCF16 I-kappa-B kinase 1 Conserved helix-loop-helix ubiquitous kinase Nuclear factor NF-kappa-B inhibitor kinase alpha Transcription factor 16 protein protein human Homo sapiens Human MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCHEIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTSFVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPKCIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRCFVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPIIQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAEIMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE DIP protein O15111 original sequence version: 91 DIP protein O15111 original sequence version: 123 DIP protein O15111 original sequence version: 133 DIP protein O15111 original sequence version: 118 DIP protein O15111 original sequence version: 125 DIP protein O15111 original sequence version: 96 4EA55C6FFC66FA16 tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A kappab enhancer Interleulin-2 receptor alpha kappaB enhancer dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid in vitro In vitro CAACGGCAGGGAATTCCCCTCTCCTT B191ED2157C50C6A rela-rela-1 1 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Complex only appears in the nucleus following pre-treatment of cells with phorbol ester rela-rela-2 3 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component physical association physical association Complex only appears in the nucleus following pre-treatment of cells with phorbol ester nfkb1_p50-rela-1 1 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Complex only appears in the nucleus following pre-treatment of cells with phorbol ester nfkb1_p50-rela-4 3 7 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component physical association physical association Complex only appears in the nucleus following pre-treatment of cells with phorbol ester rela-rela-3 2 5 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q04206:p.Cys216Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:12:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys216ala' Tue Jun 30 18:23:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys216Ala' 25 29 physical association physical association nfkb1_p50-rela-2 2 5 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association rela-chuk-1 2 5 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association