IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Human tumor necrosis factor-alpha receptor. Purification by immunoaffinity chromatography and initial characterization. Human tumor necrosis factor-alpha receptor. Purification by immunoaffinity chromatography and initial characterization. J. Biol. Chem. (0021-9258) 1988 Stauber GB., Aiyer RA., Aggarwal BB. Apoptosis - Interactions involving proteins with a function related to apoptosis Detergent solubilized (Triton X100)cells were used. TNF-alpha was radiolabeled with Na 125I. Cross-linking reagents were used like EGS and, for protein identification, DTSS (reversible). The complexes were purified using an anti TNF-alpha Immunoaffinity column and analysed by SDS-PAGE and gel filtration. human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Stauber GB., Aiyer RA., Aggarwal BB. Apoptosis - Interactions involving proteins with a function related to apoptosis Detergent solubilized (Triton X100)cells were used. TNF-alpha was radiolabeled with Na 125I. Cross-linking reagents were used like EGS and, for protein identification, DTSS (reversible). The complexes were purified using an anti TNF-alpha Immunoaffinity column and analysed by SDS-PAGE and gel filtration. J. Biol. Chem. (0021-9258) 1988 tnfa_human Tumor necrosis factor TNF TNFA TNFSF2 TNF-alpha Tumor necrosis factor ligand superfamily member 2 Cachectin protein protein human Homo sapiens Human MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL DIP protein P01375 original sequence version: 198 DIP protein P01375 original sequence version: 151 DIP protein P01375 original sequence version: 156 DIP protein P01375 original sequence version: 186 DIP protein P01375 original sequence version: 201 DIP protein P01375 original sequence version: 174 DIP protein P01375 original sequence version: 211 3DF90F96C9031FFE tnr1a_human Tumor necrosis factor receptor superfamily member 1A TNFRSF1A TNFAR TNFR1 p60 Tumor necrosis factor receptor 1 Tumor necrosis factor receptor type I p55 protein protein human Homo sapiens Human MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWKSKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYTPGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR DIP protein P19438 original sequence version: 135 DIP protein P19438 original sequence version: 150 DIP protein P19438 original sequence version: 177 4CEFBA96D03B8225 tnf-tnfrsf1a-1 1 3 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait na 125i label tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association