IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A secreted protein microarray platform for extracellular protein interaction discovery. A secreted protein microarray platform for extracellular protein interaction discovery. 2011 imex curation S R Ramani, I Tom, N Lewin-Koh, B Wranik, L DePalatis, J Zhang‡, D Eaton and L C. Gonzalez Apoptosis - Interactions involving proteins with a function related to apoptosis The normalized signals from individual spots on replicates were used to determine the mean score as described in the publication. 2011-07-29: Gonzalez L; Department of Protein Chemistry, Genentech, Inc., San Fancisco, CA , USA Protein microarray platform was prepared by immobilising proteins with Fc, polyHis or polyHis/Gln tags. Fluorescently labeled (Cy-5 labeled Fc-fusion constructs) bait was then used to probe interactions with all the arrayed proteins. Interaction was also observed between LAIR1 and COLLAGEN I BD Biosciences, this is a mix of COL1A1 and COL1A2, hence cannot be entered as a single interaction in the database. gonzal29@gene.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protein array protein array predetermined predetermined participant predetermined S R Ramani, I Tom, N Lewin-Koh, B Wranik, L DePalatis, J Zhang‡, D Eaton and L C. Gonzalez Apoptosis - Interactions involving proteins with a function related to apoptosis The normalized signals from individual spots on replicates were used to determine the mean score as described in the publication. 2011-07-29: Gonzalez L; Department of Protein Chemistry, Genentech, Inc., San Fancisco, CA , USA Protein microarray platform was prepared by immobilising proteins with Fc, polyHis or polyHis/Gln tags. Fluorescently labeled (Cy-5 labeled Fc-fusion constructs) bait was then used to probe interactions with all the arrayed proteins. Interaction was also observed between LAIR1 and COLLAGEN I BD Biosciences, this is a mix of COL1A1 and COL1A2, hence cannot be entered as a single interaction in the database. gonzal29@gene.com Accepted 2011-OCT-20 by MGT 2011 Only protein-protein interactions imex curation A secreted protein microarray platform for extracellular protein interaction discovery. A secreted protein microarray platform for extracellular protein interaction discovery. 2011 imex curation S R Ramani, I Tom, N Lewin-Koh, B Wranik, L DePalatis, J Zhang‡, D Eaton and L C. Gonzalez Apoptosis - Interactions involving proteins with a function related to apoptosis The normalized signals from individual spots on replicates were used to determine the mean score as described in the publication. 2011-07-29: Gonzalez L; Department of Protein Chemistry, Genentech, Inc., San Fancisco, CA , USA Protein microarray platform was prepared by immobilising proteins with Fc, polyHis or polyHis/Gln tags. Fluorescently labeled (Cy-5 labeled Fc-fusion constructs) bait was then used to probe interactions with all the arrayed proteins. Interaction was also observed between LAIR1 and COLLAGEN I BD Biosciences, this is a mix of COL1A1 and COL1A2, hence cannot be entered as a single interaction in the database. gonzal29@gene.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined S R Ramani, I Tom, N Lewin-Koh, B Wranik, L DePalatis, J Zhang‡, D Eaton and L C. Gonzalez Apoptosis - Interactions involving proteins with a function related to apoptosis The normalized signals from individual spots on replicates were used to determine the mean score as described in the publication. 2011-07-29: Gonzalez L; Department of Protein Chemistry, Genentech, Inc., San Fancisco, CA , USA Protein microarray platform was prepared by immobilising proteins with Fc, polyHis or polyHis/Gln tags. Fluorescently labeled (Cy-5 labeled Fc-fusion constructs) bait was then used to probe interactions with all the arrayed proteins. Interaction was also observed between LAIR1 and COLLAGEN I BD Biosciences, this is a mix of COL1A1 and COL1A2, hence cannot be entered as a single interaction in the database. gonzal29@gene.com Accepted 2011-OCT-20 by MGT 21-Dec-2011: Contacted by JYOTI. 2011 Only protein-protein interactions imex curation cd86_human T-lymphocyte activation antigen CD86 CD86 CD28LG2 Activation B7-2 antigen CTLA-4 counter-receptor B7.2 B70 FUN-1 BU63 protein protein human Homo sapiens Human MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF C249DAEEB889D911 ntri_human Neurotrimin NTM IGLON2 NT IgLON family member 2 UNQ297/PRO337 protein protein human Homo sapiens Human MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF DA4D12C295ABBE3A ceam6_human Carcinoembryonic antigen-related cell adhesion molecule 6 CEACAM6 NCA Non-specific crossreacting antigen Normal cross-reacting antigen protein protein human Homo sapiens Human MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI 28469487A74C18A4 psg5_human Pregnancy-specific beta-1-glycoprotein 5 PSG5 Fetal liver non-specific cross-reactive antigen 3 protein protein human Homo sapiens Human MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKGQLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTFNLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRNETGPYECEIRDRDGGMRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI E14EA6E9DAA88296 mo2r1_human Cell surface glycoprotein CD200 receptor 1 CD200R1 CD200R CRTR2 MOX2R OX2R CD200 cell surface glycoprotein receptor Cell surface glycoprotein OX2 receptor 1 UNQ2522/PRO6015 protein protein human Homo sapiens Human MLCPWRTANLGLLLILTIFLVAASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLIIITWEIILRGQPSCTKAYKKETNETKETNCTDERITWVSRPDQNSDLQIRTVAITHDGYYRCIMVTPDGNFHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAHISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHNVSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL A7E761243FA346DC nect2_human Nectin-2 NECTIN2 HVEB Herpes virus entry mediator B Nectin cell adhesion molecule 2 PRR2 PVRL2 Poliovirus receptor-related protein 2 protein protein human Homo sapiens Human MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGGIIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEMPSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV DIP protein Q92692 original sequence version: 131 DIP protein Q92692 original sequence version: 134 3AE4F83E92F6F624 tie1_human Tyrosine-protein kinase receptor Tie-1 TIE1 TIE protein protein human Homo sapiens Human MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA 3B42BE33678C58A1 tnr16_human Tumor necrosis factor receptor superfamily member 16 NGFR TNFRSF16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein human Homo sapiens Human MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKLLNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDALLAALRRIQRADLVESLCSESTATSPV DIP protein P08138 original sequence version: 143 B09FA143FB3D625B jam2_human Junctional adhesion molecule B JAM2 C21orf43 VEJAM Junctional adhesion molecule 2 Vascular endothelial junction-associated molecule UNQ219/PRO245 protein protein human Homo sapiens Human MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCGLGVCYAQRKGYFSKETSFQKSNSSSKATTMSENDFKHTKSFII CA78E518E22DCAEE bt3a1_human Butyrophilin subfamily 3 member A1 BTN3A1 BTF5 protein protein human Homo sapiens Human MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILTLEPTALTICPA 8D834D70526D1F6F ceam7_human Carcinoembryonic antigen-related cell adhesion molecule 7 CEACAM7 CGM2 Carcinoembryonic antigen CGM2 protein protein human Homo sapiens Human MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI B6B836F66BD10D3B clmp_human CXADR-like membrane protein CLMP ACAM ASAM Adipocyte adhesion molecule Coxsackie- and adenovirus receptor-like membrane protein UNQ318/PRO363 protein protein human Homo sapiens Human MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAPKARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHHANLTKAETTPSMIPSQSRAFQTV FDA215EB3B3C4335 fcrl4_human Fc receptor-like protein 4 FCRL4 FCRH4 IFGP2 IRTA1 Fc receptor homolog 4 IFGP family protein 2 Immune receptor translocation-associated protein 1 protein protein human Homo sapiens Human MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRESGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWNGNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNVTVRETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGFLGDETRLPPAPGPGESSHSICPAQVELQSLYVDVHPKKGDLVYSEIQTTQLGEEEEANTSRTLLEDKDVSVVYSEVKTQHPDNSAGKISSKDEES F3B7AD14FB1B449A cd28_human T-cell-specific surface glycoprotein CD28 CD28 TP44 protein protein human Homo sapiens Human MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS 1D9B6552A5878D0F slaf7_human SLAM family member 7 SLAMF7 CS1 CD2 subset 1 CD2-like receptor-activating cytotoxic cells Membrane protein FOAP-12 Novel Ly9 Protein 19A UNQ576/PRO1138 protein protein human Homo sapiens Human MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI D09ABBCFF74BE8D4 ceam1_human Carcinoembryonic antigen-related cell adhesion molecule 1 CEACAM1 BGP BGP1 Biliary glycoprotein 1 protein protein human Homo sapiens Human MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCHANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ DIP protein P13688 original sequence version: 164 CAD1B2328D069AF8 ceam5_human Carcinoembryonic antigen-related cell adhesion molecule 5 CEACAM5 CEA Carcinoembryonic antigen Meconium antigen 100 protein protein human Homo sapiens Human MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAGATVGIMIGVLVGVALI DIP protein P06731 original sequence version: 110 86318E244155DB58 cd2_human T-cell surface antigen CD2 CD2 SRBC Erythrocyte receptor LFA-2 LFA-3 receptor Rosette receptor T-cell surface antigen T11/Leu-5 protein protein human Homo sapiens Human MSFPCKFVASFLLIFNVSSKGAVSKEITNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYKLFKNGTLKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQERVSKPKISWTCINTTLTCEVMNGTDPELNLYQDGKHLKLSQRVITHKWTTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVFVALLVFYITKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHRPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN A03D853C3B618917 tff2_human Trefoil factor 2 TFF2 SML1 Spasmolysin Spasmolytic polypeptide protein protein human Homo sapiens Human MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY 6A296A11AD9CCC5D jaml_human Junctional adhesion molecule-like JAML AMICA1 Adhesion molecule interacting with CXADR antigen 1 Dendritic cell-specific protein CREA7-1 UNQ722/PRO1387 protein protein human Homo sapiens Human MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLSPGEHAKDEYVLYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRLKGESQVFKKAVVLHVLPEEPKELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEEIVFRYYHKLRMSVEYSQSWGHFQNRVNLVGDIFRNDGSIMLQGVRESDGGNYTCSIHLGNLVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVGIVCATILLLPVLILIVKKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF 64B542F9384C7642 lsamp_human Limbic system-associated membrane protein LSAMP IGLON3 LAMP IgLON family member 3 protein protein human Homo sapiens Human MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC 88CF00E07302817B sigl8_human Sialic acid-binding Ig-like lectin 8 SIGLEC8 SAF2 Sialoadhesin family member 2 protein protein human Homo sapiens Human MLLLLLLLPLLWGTKGMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWACKQGTPPMISWIGASVSSPGPTTARSSVLTLTPKPQDHGTSLTCQVTLPGTGVTTTSTVRLDVSYPPWNLTMTVFQGDATASTALGNGSSLSVLEGQSLRLVCAVNSNPPARLSWTRGSLTLCPSRSSNPGLLELPRVHVRDEGEFTCRAQNAQGSQHISLSLSLQNEGTGTSRPVSQVTLAAVGGAGATALAFLSFCIIFIIVRSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTESWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRETAETQACLRNHNPSSKEVRG 086EFF989B74123C lair1_human Leukocyte-associated immunoglobulin-like receptor 1 LAIR1 CD305 protein protein human Homo sapiens Human MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYNDTEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGPTQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLLLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESITYAAVARH 752EFB2FCC29B8E8 pdcd1_human Programmed cell death protein 1 PDCD1 PD1 protein protein human Homo sapiens Human MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL DIP protein Q15116 original sequence version: 143 A5210FD40C304FB7 cxar_human Coxsackievirus and adenovirus receptor Coxsackievirus B-adenovirus receptor HCVADR CVB3-binding protein CXADR CAR protein protein human Homo sapiens Human MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSKDGSIV AB01C6346CB7FE64 cart_human Cocaine- and amphetamine-regulated transcript protein CARTPT CART protein protein human Homo sapiens Human MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL FC396CA2C032AA83 igs11_human Immunoglobulin superfamily member 11 IGSF11 BTIGSF CXADRL1 VSIG3 Brain and testis-specific immunoglobulin superfamily protein V-set and immunoglobulin domain-containing protein 3 protein protein human Homo sapiens Human MTSQRSPLAPLLLLSLHGVAASLEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIGLIAGAIGTGAVIIIFCIALILGAFFYWRSKNKEEEEEEIPNEIREDDLPPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKPRPPHTHSYTISHATLERIGAVPVMVPAQSRAGSLV 724985A1F8DEA8FC jam3_human Junctional adhesion molecule C JAM3 JAM-2 Junctional adhesion molecule 3 UNQ859/PRO1868 protein protein human Homo sapiens Human MALRRPPRLRLCARLPDFFLLLLFRGCLIGAVNLKSSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQGDLAGRAEILGKTSLKIWNVTRRDSALYRCEVVARNDRKEIDEIVIELTVQVKPVTPVCRVPKAVPVGKMATLHCQESEGHPRPHYSWYRNDVPLPTDSRANPRFRNSSFHLNSETGTLVFTAVHKDDSGQYYCIASNDAGSARCEEQEMEVYDLNIGGIIGGVLVVLAVLALITLGICCAYRRGYFINNKQDGESYKNPGKPDGVNYIRTDEEGDFRHKSSFVI CE39ADF33EA1DAB9 ctla4_human Cytotoxic T-lymphocyte protein 4 CTLA4 CD152 Cytotoxic T-lymphocyte-associated antigen 4 protein protein human Homo sapiens Human MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN DIP protein P16410 original sequence version: 178 6F9466FB2E139A5A lfa3_human Lymphocyte function-associated antigen 3 Surface glycoprotein LFA-3 CD58 LFA3 protein protein human Homo sapiens Human MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN 34D635DF1D14FE2E esam_human Endothelial cell-selective adhesion molecule ESAM UNQ220/PRO246 protein protein human Homo sapiens Human MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV C5E3F302F41B6EEC tigit_human T-cell immunoreceptor with Ig and ITIM domains TIGIT VSIG9 VSTM3 V-set and immunoglobulin domain-containing protein 9 V-set and transmembrane domain-containing protein 3 protein protein human Homo sapiens Human MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQIPLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG B890AF73F618C851 by55_human CD160 antigen CD160 BY55 Natural killer cell receptor BY55 protein protein human Homo sapiens Human MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL EF0B981ACC7478BD nect1_human Nectin-1 NECTIN1 HVEC Herpes virus entry mediator C Herpesvirus Ig-like receptor Nectin cell adhesion molecule 1 PRR1 PVRL1 Poliovirus receptor-related protein 1 protein protein human Homo sapiens Human MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISRYRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEYHWTTLNGSLPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAGPVPTAIIGGVAGSILLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPDDSDDEKKAGPLGGSSYEEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQYDPEQLDLAENMVSQNDGSFISKKEWYV DIP protein Q15223 original sequence version: 122 DF34C8AEC893EE6D ceam8_human Carcinoembryonic antigen-related cell adhesion molecule 8 CEACAM8 CGM6 CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 protein protein human Homo sapiens Human MGPISAPSCRWRIPWQGLLLTASLFTFWNPPTTAQLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSDALVQGSSPGLSARATVSIMIGVLARVALI AACF74DA1AC839D8 btnl8_human Butyrophilin-like protein 8 BTNL8 UNQ702/PRO1347 protein protein human Homo sapiens Human MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEAMEVRFFRGQFSSVVHLYRDGKDQPFMQMPQYQGRTKLVKDSIAEGRISLRLENITVLDAGLYGCRISSQSYYQKAIWELQVSALGSVPLISITGYVDRDIQLLCQSSGWFPRPTAKWKGPQGQDLSTDSRTNRDMHGLFDVEISLTVQENAGSISCSMRHAHLSREVESRVQIGDTFFEPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQWKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPKLCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQSFQAGKHYWEVDGGHNKRWRVGVCRDDVDRRKEYVTLSPDHGYWVLRLNGEHLYFTLNPRFISVFPRTPPTKIGVFLDYECGTISFFNINDQSLIYTLTCRFEGLLRPYIEYPSYNEQNGTPIVICPVTQESEKEASWQRASAIPETSNSESSSQATTPFLPRGEM 3314E96421533C74 pvr_human Poliovirus receptor PVR PVS Nectin-like protein 5 protein protein human Homo sapiens Human MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVLGILVFLILLGIGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR DIP protein P15151 original sequence version: 140 D15C012CE853169B tff1_human Trefoil factor 1 Protein pS2 Polypeptide P1.A Breast cancer estrogen-inducible protein PNR-2 TFF1 BCEI PS2 protein protein human Homo sapiens Human MATMENKVICALVLVSMLALGTLAEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF 65198523BAD6EBC7 negr1_human Neuronal growth regulator 1 NEGR1 IGLON4 IgLON family member 4 UNQ2433/PRO4993 protein protein human Homo sapiens Human MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKNAILQ 41B05D00224CF34A btla_human B- and T-lymphocyte attenuator BTLA B- and T-lymphocyte-associated protein protein protein human Homo sapiens Human MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS DIP protein Q7Z6A9 original sequence version: 66 F4D1FF775D7D33F3 mpzl2_human Myelin protein zero-like protein 2 MPZL2 EVA EVA1 Epithelial V-like antigen 1 UNQ606/PRO1192 protein protein human Homo sapiens Human MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD 9D19EBA798B5815A tnr14_human Tumor necrosis factor receptor superfamily member 14 TNFRSF14 HVEA HVEM UNQ329/PRO509 Herpes virus entry mediator A Tumor necrosis factor receptor-like 2 protein protein human Homo sapiens Human MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH DIP protein Q92956 original sequence version: 121 46CE13C2C70242C1 ox2g_human OX-2 membrane glycoprotein CD200 MOX1 MOX2 My033 protein protein human Homo sapiens Human MERLVIRMPFSHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDRGELSQGVQKMT 38DF327B382CC970 clm5_human CMRF35-like molecule 5 CD300LD CD300D CMRF35A4 CD300 antigen-like family member D CMRF35-A4 UNQ9218/PRO28686 protein protein human Homo sapiens Human MWLSPSLLLLILPGYSIAAKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS 5E3A4CB03B473E12 nect3_human Nectin-3 NECTIN3 CDw113 Nectin cell adhesion molecule 3 PRR3 PVRL3 Poliovirus receptor-related protein 3 protein protein human Homo sapiens Human MARTLRPSPLCPGGGKAQLSSASLLGAGLLLQPPTPPPLLLLLFPLLLFSRLCGALAGPIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDLGEMESTTTSFPNETATIISQYKLFPTRFARGRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQKVIYISDPPTTTTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVSVLAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV 6D1104CCB4A9D731 nect4_human Nectin-4 NECTIN4 Ig superfamily receptor LNIR LNIR Nectin cell adhesion molecule 4 PRR4 PVRL4 Poliovirus receptor-related protein 4 protein protein human Homo sapiens Human MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV DIP protein Q96NY8 original sequence version: 100 DIP protein Q96NY8 original sequence version: 105 DIP protein Q96NY8 original sequence version: 90 DIP protein Q96NY8 original sequence version: 97 DCF5E1D794F227FA slaf1_human Signaling lymphocytic activation molecule SLAMF1 SLAM family member 1 SLAM CDw150 IPO-3 protein protein human Homo sapiens Human MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES DIP protein Q13291 original sequence version: 151 DIP protein Q13291 original sequence version: 110 DIP protein Q13291 original sequence version: 106 DIP protein Q13291 original sequence version: 112 BFB0F27EA31D8C04 cd226_human CD226 antigen CD226 DNAM1 DNAX accessory molecule 1 protein protein human Homo sapiens Human MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV 5379182CC4695097 mpzl3_human Myelin protein zero-like protein 3 MPZL3 UNQ2966/PRO7425 protein protein human Homo sapiens Human MQQRGAAGSRGCALFPLLGVLFFQGVYIVFSLEIRADAHVRGYVGEKIKLKCTFKSTSDVTDKLTIDWTYRPPSSSHTVSIFHYQSFQYPTTAGTFRDRISWVGNVYKGDASISISNPTIKDNGTFSCAVKNPPDVHHNIPMTELTVTERGFGTMLSSVALLSILVFVPSAVVVALLLVRMGRKAAGLKKRSRSGYKKSSIEVSDDTDQEEEEACMARLCVRCAECLDSDYEETY 009B7ED8C82C7B4F pd1l1_human Programmed cell death 1 ligand 1 CD274 B7H1 PDCD1L1 PDCD1LG1 PDL1 B7 homolog 1 protein protein human Homo sapiens Human MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET FE957086E62A31A8 cd80_human T-lymphocyte activation antigen CD80 CD80 CD28LG CD28LG1 LAB7 Activation B7-1 antigen CTLA-4 counter-receptor B7.1 BB1 protein protein human Homo sapiens Human MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV BA453EE34528B1F4 clmp-clmp 1 ASAM 14 unspecified role unspecified role prey prey ASAM 14 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 5.1 cd80-ngfr 1 NGFR 10 unspecified role unspecified role prey prey CD80 53 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 14 cd80-cd274 1 CD274 52 unspecified role unspecified role prey prey CD80 53 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 12.2 cd80-cd28 1 CD80 53 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CD28 16 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 10.7 cd80-ctla4 1 CD80 53 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CTLA4 31 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 9.4 cd274-pdcd1 1 CD274 52 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PDCD1 26 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 15.1 cd274-cd80 1 CD80 53 unspecified role unspecified role prey prey CD274 52 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 8.1 btla-tnfrsf14 1 BTLA 42 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal TNFRSF14 44 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 19 btn3a1-tff1 1 BTN3A1 12 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal TFF1 40 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 7.4 btnl8-tff1 1 TFF1 40 unspecified role unspecified role prey prey BTNL8 38 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 7.3 cd160-tnfrsf14 1 CD160 35 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal TNFRSF14 44 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 10.2 cd2-cd58 1 CD58 32 unspecified role unspecified role prey prey CD2 20 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 6.7 cd200-cd200r1 1 CD200 45 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CD200R1 7 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 8.6 cd200r1-cd200 1 CD200R1 7 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CD200 45 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 15 cd226-pvr 1 PVR 39 unspecified role unspecified role prey prey CD226 50 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 10.3 cd226-pvrl2 1 PVRL2 8 unspecified role unspecified role prey prey CD226 50 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 10 cd300ld-tff1 1 TFF1 40 unspecified role unspecified role prey prey CD300LD 46 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 4.7 ceacam1-ceacam6 1 CEACAM6 5 unspecified role unspecified role prey prey CEACAM1 18 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 9.9 ceacam1-ceacam1 1 CEACAM1 18 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CEACAM1 18 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 9.7 ceacam1-cartpt 1 CEACAM1 18 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CARTPT 28 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 9.2 ceacam1-ceacam8 1 CEACAM1 18 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CEACAM8 37 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 9.1 ceacam1-ceacam7 1 CEACAM7 13 unspecified role unspecified role prey prey CEACAM1 18 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 8.4 ceacam1-ceacam5 1 CEACAM1 18 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CEACAM5 19 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 4.6 ceacam6-ceacam8 1 CEACAM6 5 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CEACAM8 37 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 16 ceacam6-cartpt 1 CARTPT 28 unspecified role unspecified role prey prey CEACAM6 5 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 15.6 ceacam6-ceacam1 1 CEACAM6 5 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CEACAM1 18 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 15.2 ceacam6-ceacam6 1 CEACAM6 5 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CEACAM6 5 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 14.6 ceacam6-ceacam7 1 CEACAM6 5 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CEACAM7 13 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 9.5 ceacam6-ceacam5 1 CEACAM5 19 unspecified role unspecified role prey prey CEACAM6 5 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 8.5 ctla4-cd86 1 CTLA4 31 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CD86 3 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 7.3 ctla4-cd80 1 CTLA4 31 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CD80 53 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 6.6 cxadr-amica1 1 CXADR 27 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal AMICA1 22 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 5.6 cxadr-cxadr 1 CXADR 27 unspecified role unspecified role prey prey CXADR 27 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 5.2 esam-esam 1 ESAM 33 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal ESAM 33 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 6.5 fcrl4-tff1 1 FCRL4 15 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal TFF1 40 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 10 fcrl4-tff2 1 FCRL4 15 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal TFF2 21 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 5 igsf11-igsf11 1 IGSF11 29 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal IGSF11 29 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 6.3 jam2-jam3 1 JAM3 30 unspecified role unspecified role prey prey JAM2 11 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 12.2 jam2-jam2 1 JAM2 11 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal JAM2 11 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 7.5 jam3-jam2 1 JAM2 11 unspecified role unspecified role prey prey JAM3 30 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 10.6 jam3-jam3 1 JAM3 30 unspecified role unspecified role prey prey JAM3 30 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 6.5 lair1-lair1 1 LAIR1 25 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal LAIR1 25 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 8.2 pvrl4-pvrl1 1 PVRL4 48 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL1 36 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 11.6 pvrl4-pvrl2 1 PVRL2 8 unspecified role unspecified role prey prey PVRL4 48 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 8.1 pvrl4-tigit 1 TIGIT 34 unspecified role unspecified role prey prey PVRL4 48 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 4.2 lsamp-lsamp 1 LSAMP 23 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal LSAMP 23 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 8.1 lsamp-negr1 1 LSAMP 23 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal NEGR1 41 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 4 mpzl3-mpzl2 1 MPZL3 51 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal MPZL2 43 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 5.2 negr1-negr1 1 NEGR1 41 unspecified role unspecified role prey prey NEGR1 41 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 6.7 negr1-lsamp 1 LSAMP 23 unspecified role unspecified role prey prey NEGR1 41 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 6.5 pdcd1-cd274 1 PDCD1 26 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CD274 52 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 8.2 psg5-tie1 1 TIE1 9 unspecified role unspecified role prey prey PSG5 6 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 4.2 pvrl1-pvrl4 1 PVRL1 36 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL4 48 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 9.2 pvrl1-pvrl3 1 PVRL1 36 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL3 47 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 8.6 pvrl1-pvrl1 1 PVRL1 36 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL1 36 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 7.2 pvrl2-cd226 1 PVRL2 8 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal CD226 50 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 14.3 pvrl2-pvrl3 1 PVRL3 47 unspecified role unspecified role prey prey PVRL2 8 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 13.8 pvrl2-pvrl2 1 PVRL2 8 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL2 8 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 10.7 pvrl3-pvrl1 1 PVRL3 47 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL1 36 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 18.1 pvrl3-pvrl2 1 PVRL3 47 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL2 8 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 16.1 pvrl3-tigit 1 TIGIT 34 unspecified role unspecified role prey prey PVRL3 47 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 7.9 siglec8-tff1 1 TFF1 40 unspecified role unspecified role prey prey SIGLEC8 24 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 4.9 slamf1-slamf1 1 SLAMF1 49 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal SLAMF1 49 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 7.7 slamf7-slamf7 1 SLAMF7 17 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal SLAMF7 17 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 5.6 tigit-pvrl2 1 PVRL2 8 unspecified role unspecified role prey prey TIGIT 34 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 17.2 tigit-pvrl3 1 TIGIT 34 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL3 47 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 15.5 tigit-pvrl4 1 TIGIT 34 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVRL4 48 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 14 tigit-pvr 1 TIGIT 34 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal PVR 39 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 10.4 ntm-lsamp 1 NTM 4 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal LSAMP 23 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 10.7 ntm-negr1 1 NTM 4 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal NEGR1 41 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 9.7 ntm-ntm 1 NTM 4 unspecified role unspecified role prey prey NTM 4 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal physical association physical association Table 2, Figure 5 6.2 lsamp-ntm 1 LSAMP 23 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal NTM 4 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 11.4 negr1-ntm 1 NEGR1 41 unspecified role unspecified role bait bait c terminal fc-igg tag fc-igg tag c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal c-terminal c-terminal position c-term carboxy-terminus c-terminus c-term c-terminus carboxy-terminus c-terminal NTM 4 unspecified role unspecified role prey prey physical association physical association Table 2, Figure 5 8.2 cd80-ngfr-4 2 10 unspecified role unspecified role prey prey 53 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 tff1-btn3a1 2 12 unspecified role unspecified role prey prey 40 unspecified role unspecified role bait bait direct interaction direct interaction btnl8-tff1-3 2 40 unspecified role unspecified role prey prey 38 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 tff1-cd300ld 2 46 unspecified role unspecified role prey prey 40 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 fcrl4-tff1-3 2 40 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 siglec8-tff1-3 2 40 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 ceacam1-cartpt-1 2 28 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 cartpt-ceacam6-2 2 5 unspecified role unspecified role prey prey 28 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 fcrl4-tff2-3 2 21 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 mpzl2-mpzl3-2 2 51 unspecified role unspecified role prey prey 43 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 tie1-psg5 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 cartpt-ceacam1 2 28 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey direct interaction direct interaction Table 2 tff2-fcrl4 2 21 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey direct interaction direct interaction Table 2 tff1-fcrl4 2 15 unspecified role unspecified role prey prey 40 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 siglec8-tff1-4 2 40 unspecified role unspecified role bait bait 24 unspecified role unspecified role prey prey direct interaction direct interaction Table 2 psg5-tie1-1 2 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction Table 2 mpzl3-mpzl2-1 2 43 unspecified role unspecified role prey prey 51 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 tff1-btnl8 2 38 unspecified role unspecified role prey prey 40 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 ceacam6-cartpt-1 2 28 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait direct interaction direct interaction Table 2 btn3a1-tff1-1 2 40 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait direct interaction direct interaction ngfr-cd80 2 10 unspecified role unspecified role bait bait 53 unspecified role unspecified role prey prey direct interaction direct interaction Table 2 cd300ld-tff1-1 2 40 unspecified role unspecified role prey prey 46 unspecified role unspecified role bait bait direct interaction direct interaction Table 2