InnateDB InnateDB Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Nat. Immunol. (1529-2908) 2011 imex curation Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org Accepted 2013-MAY-13 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Nat. Immunol. (1529-2908) 2011 imex curation Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org Accepted 2013-MAY-13 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Nat. Immunol. (1529-2908) 2011 imex curation Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-epithelium Mus musculus epithelium Epithelium [epithelial cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. primary kidney epithelial cells The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org Accepted 2013-MAY-13 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Nat. Immunol. (1529-2908) 2011 imex curation Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org Accepted 2013-MAY-13 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Treatment with IL-17 prolongs the half-life of chemokine CXCL1 mRNA via the adaptor TRAF5 and the splicing-regulatory factor SF2 (ASF). Nat. Immunol. (1529-2908) 2011 imex curation Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sun D., Novotny M., Bulek K., Liu C., Li X., Hamilton T. Apoptosis - Interactions involving proteins with a function related to apoptosis Still several interactions have not been annotated, without any explanation given as to why. As this publication has taken ~18 months to redo corrections, I have added missing endogenous interactions (Figs 3b, 4b + e) myself, in the hope that is may be possible to add more interactions. The authors have stated that TRAF constructs are of Human origin and Act1 and Tak1 constructs are of murine origin. The identity of Act1 (Traf3ip2) was derived from PMID: 10962024 and Qian et al., 2007. hamiltt@ccf.org Accepted 2013-MAY-13 by MGT 17-Jun-2013: Contacted by IntAct-Help. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV DIP protein Q9Y4K3 original sequence version: 154 DIP protein Q9Y4K3 original sequence version: 91 DIP protein Q9Y4K3 original sequence version: 114 DIP protein Q9Y4K3 original sequence version: 118 DIP protein Q9Y4K3 original sequence version: 140 DIP protein Q9Y4K3 original sequence version: 159 DIP protein Q9Y4K3 original sequence version: 132 DIP protein Q9Y4K3 original sequence version: 158 DIP protein Q9Y4K3 original sequence version: 171 DIP protein Q9Y4K3 original sequence version: 117 DIP protein Q9Y4K3 original sequence version: 113 5AB9C255CCFEE749 srsf1_mouse Serine/arginine-rich splicing factor 1 Sfrs1 Splicing factor, arginine/serine-rich 1 Srsf1 ASF/SF2 Pre-mRNA-splicing factor SRp30a protein protein mouse Mus musculus Mouse MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT DIP protein Q6PDM2 original sequence version: 80 C28A0B2F112EA713 traf5_mouse TNF receptor-associated factor 5 Traf5 protein protein mouse Mus musculus Mouse MAHSEEQAAVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDLTDLEDL DIP protein P70191 original sequence version: 132 48F64FB83BD587E5 ciks_human E3 ubiquitin ligase TRAF3IP2 Connection to IKK and SAPK/JNK TRAF3-interacting protein 2 Nuclear factor NF-kappa-B activator 1 TRAF3IP2 C6orf4 C6orf5 C6orf6 C6orf2 Adapter protein CIKS E3 ubiquitin-protein ligase CIKS protein protein human Homo sapiens Human MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNRAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDTAMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL 4985795466D71422 traf5_human TNF receptor-associated factor 5 RING finger protein 84 TRAF5 RNF84 protein protein human Homo sapiens Human MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL 86EB3724CE111176 traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 ciks_mouse E3 ubiquitin ligase TRAF3IP2 Traf3ip2 Adapter protein CIKS Connection to IKK and SAPK/JNK E3 ubiquitin-protein ligase CIKS Nuclear factor NF-kappa-B activator 1 TRAF3-interacting protein 2 protein protein mouse Mus musculus Mouse MNRSIPVEVDESEPFPSQLLKPIPEYSPEEELEPPAPNTRNMAPSSLSVLQCPPLKLANHQPVSQQVTCLRAKVLEEGEASFFRRHPELGKDISSCSSGASEPESELGALPPEHRFTLTEKRNRWLGSQLSAASPDTGHESDKSDPSLPNALADSFSGGQEMMPRPRPRPGPHRHRAAPDVPTIDTGYDSQPQDVLGIRQLERPLPLTSSCYLQDLPGPLRSRELPPQFELERYPMNAQLLPPHPSPQAPWNCQYYCPGGPYHHQVPHGHGYPPAAAYQQVLQPALPGQVLPGARARGPRPVQKVILNDSSPQDQEERPAQRDFSFPRLPRDQLYRPPSNGVEAPEESLDLPAELRPHGPQAPSLAAVPRPPSNPLARGTLRTSNLPEELRKVFITYSMDTAMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFISQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL 54B40C8D81C3D827 srsf1_human Serine/arginine-rich splicing factor 1 SF2 SF2P33 OK/SW-cl.3 SRSF1 ASF pre-mRNA-splicing factor SF2, P33 subunit Alternative-splicing factor 1 SFRS1 Splicing factor, arginine/serine-rich 1 protein protein human Homo sapiens Human MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT DIP protein Q07955 original sequence version: 191 DIP protein Q07955 original sequence version: 160 C28A0B2F112EA713 m3k7_mouse Mitogen-activated protein kinase kinase kinase 7 Map3k7 Tak1 Transforming growth factor-beta-activated kinase 1 protein protein mouse Mus musculus Mouse MSTASAASSSSSSSASEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIVATAGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPARSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS DIP protein Q62073 original sequence version: 121 DIP protein Q62073 original sequence version: 108 DIP protein Q62073 original sequence version: 151 97C8F6F3C8E283EE traf3ip2-traf5 2 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig. 3C IL-17 traf5-srsf1 4 13 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association Fig. 3B, 4B. IL-17 traf3ip2-srsf1 4 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey association association Fig. 4E IL-17 traf5-traf3ip2 3 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig.7B IL-17 traf2-traf3ip2 5 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3Ai traf2-traf3ip2-1 5 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3Aii traf5-traf3ip2-1 5 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3Aiii traf5-srsf1-2 1 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4C traf5-srsf1-3 1 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 4C traf6-map3k7-1 5 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4D