IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. J. Biol. Chem. (0021-9258) 2011 imex curation Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Accepted 2011-AUG-25 by ORCHARD J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. J. Biol. Chem. (0021-9258) 2011 imex curation Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Only protein-protein interactions in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel autoradiography autoradiography Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Accepted 2011-AUG-25 by ORCHARD J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. J. Biol. Chem. (0021-9258) 2011 imex curation Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Only protein-protein interactions in vitro In vitro in gel kinase assay in-gel kinase assay in gel kinase assay autoradiography autoradiography Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Accepted 2011-AUG-25 by ORCHARD J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. J. Biol. Chem. (0021-9258) 2011 imex curation Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis znf622 and map3k5 construct origins inferred from mutants mapping. hyunha@chungbuk.ac.kr Accepted 2011-AUG-25 by ORCHARD J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. J. Biol. Chem. (0021-9258) 2011 imex curation Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Only protein-protein interactions mouse-nih_3t3 Mus musculus Swiss NIH 3t3 embryo fibroblast cells nih_3t3 Mouse Swiss NIH embryo contact inhibited fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Accepted 2011-AUG-25 by ORCHARD J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. Positive regulation of apoptosis signal-regulating kinase 1 signaling by ZPR9, a zinc finger protein. J. Biol. Chem. (0021-9258) 2011 imex curation Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Only protein-protein interactions human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Seong H.A., Jung H., Manoharan R., Ha H. Apoptosis - Interactions involving proteins with a function related to apoptosis hyunha@chungbuk.ac.kr Accepted 2011-AUG-25 by ORCHARD J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation m3k5_mouse Mitogen-activated protein kinase kinase kinase 5 MAPK/ERK kinase kinase 5 Apoptosis signal-regulating kinase 1 Map3k5 Ask1 Mekk5 protein protein mouse Mus musculus Mouse MGTEAGEGITFSVPPFASVGFCTIPEGGSCRRGGGAATAAEGEPSLQPLLVPPPPPPPGSFWNVESAAAPGTSCPTTAPGSSATRGRGNSGSGGGRRTTVAYVINEASQGQLVVAESEALQSLREACEAVGATLETLHFGKLDFGETAVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTVCTGNYTFIPYMVTPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFVQLLKVAQASSSQYFRESILSDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQSEEQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHLRVIQASEKLFRLKTPAWYLKSIVETILIYKHFVKLTTEQPSAKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFGASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKRFFEMVNTITEEKGRGAEDGDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLIDEFLKVSSKKKKTQPKLSALSTGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKADPFSFKARAKSCGEKDGKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKVVRNLMESLAQGAEEPKLKWEHITTLISSLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADPEDLDVEDEHEELSSNQTVRRPQAITEDAVATSGVSTLSSTVSHDSQNAHRSLNVQLGRMKIETNRLLEELVRKERELQALLHQAIEEKDQEIRHLKLKSQPIDIPGFPVCHLNSPGTTTEDSELPGWLRENGADEDTISRFLAEDYTLVDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKC DIP protein O35099 original sequence version: 123 BE68D225EBBCDF38 m3k5_human Mitogen-activated protein kinase kinase kinase 5 MAPK/ERK kinase kinase 5 Apoptosis signal-regulating kinase 1 MAP3K5 ASK1 MAPKKK5 MEKK5 protein protein human Homo sapiens Human MSTEADEGITFSVPPFAPSGFCTIPEGGICRRGGAAAVGEGEEHQLPPPPPGSFWNVESAAAPGIGCPAATSSSSATRGRGSSVGGGSRRTTVAYVINEASQGQLVVAESEALQSLREACETVGATLETLHFGKLDFGETTVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDTNSDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGPICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIRQRVDNIEVLTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNRRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDHGASWFKKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLANDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVDFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFSASSVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRSTEEGDCESDLLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAPEIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSNEYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGIPDENFEDHSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEEPKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDVEDDHEEQPSNQTVRRPQAVIEDAVATSGVSTLSSTVSHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT DIP protein Q99683 original sequence version: 83 DIP protein Q99683 original sequence version: 151 DIP protein Q99683 original sequence version: 113 265BDC65968AF985 mp2k3_human Dual specificity mitogen-activated protein kinase kinase 3 MAPK/ERK kinase 3 MAP2K3 MEK3 MKK3 PRKMK3 SKK2 Stress-activated protein kinase kinase 2 protein protein human Homo sapiens Human MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS DIP protein P46734 original sequence version: 154 DIP protein P46734 original sequence version: 108 A80BA4FDFF8F75A2 thio_human Thioredoxin ATL-derived factor Surface-associated sulphydryl protein TXN TRDX TRX TRX1 protein protein human Homo sapiens Human MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV DIP protein P10599 original sequence version: 174 DIP protein P10599 original sequence version: 133 DIP protein P10599 original sequence version: 181 DIP protein P10599-1 original sequence version: 180 256F4E3C8A187693 zn622_mouse Zinc finger protein 622 Znf622 D15Ertd806e Zfp622 protein protein mouse Mus musculus Mouse MAALTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAAMAPVTAEGFQERVRAQRAVAEAAEASKGAATYCTACGKKFATFNAYENHLGSRRHAELERKAVRAASRRVELLNAKNLEKGLGADGVDKDAVNAAIQQAIKAQPSTSPKKAPFVPTDECGRAAAGARGVPERDPTEKPPRLQWFEQQAKKLAKQQWEDGEEEGEEEEEDDEDEDWEDIDSDDGLECEDPGVEDQDAEDAAAEESPPLGAIPITDCLFCSHHSSSLVKNVAHMTKVHSFFIPDIEYLSDLKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDYKEGQDPAELEALSTDKILECDDETMELILPSGARVGHRSLMRYYKQRFGLPRAVTVARNQKAVGRVLQQYRALGWMGSTGAALMRERDMQYVQRMKSKWMLKIGMKNNATKQMHFRAQVRF 651A9B25964DF6E4 zn622_human Zinc finger protein 622 ZPR9 Zinc finger-like protein 9 ZNF622 protein protein human Homo sapiens Human MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGVDSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRLQWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEAEEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF 88E75FAEAB46C62B 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 znf622-map3k5 1 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 1a right, 1c H2O2, TNF-a, ionomycin (drug inducing calcium overload) and thapsigargin (drug inducing ER stress) act increasing the interaction (fig 1c). znf622-map3k5-1 6 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 1a right znf622-map3k5-9 5 7 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 1a right znf622-map3k5-3 2 12 unspecified role unspecified role neutral component neutral component purified purified region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q99683:p.[Cys1351Ser;Cys1360Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 11:00:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1360ser,cys1351ser' Wed May 02 17:52:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1351ser,cys1360ser' Tue Jun 30 17:10:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys1351Ser;Cys1360Ser]' Q99683:p.Cys1351Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:43:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1351ser' Tue Jun 30 18:24:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys1351Ser' Q99683:p.Cys1360Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:34:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1360ser' Tue Jun 30 16:47:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys1360Ser' ecoli Escherichia coli (strain K12) The point mutation analysis was performed using the m3k5-C-terminal fragment instead of the full-length protein (fig 2b). direct interaction direct interaction 2c znf622-map3k5-5 2 8 unspecified role unspecified role neutral component neutral component purified purified region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) The point mutation analysis was performed using the m3k5-C-terminal fragment instead of the full-length protein (fig 2b). 12 unspecified role unspecified role neutral component neutral component purified purified Q969S3:p.Cys308Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:11:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys308ser' Tue Jun 30 19:57:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys308Ser' Q969S3:p.[Cys305Ser;Cys308Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:56:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys305ser,cys308ser' Tue Jun 30 17:39:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys305Ser;Cys308Ser]' Q969S3:p.Cys305Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:51:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys305ser' Tue Jun 30 20:17:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys305Ser' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1b, 2c map3k5-znf622-3 1 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2d DTT and b-ME (reducing agents) can disrupt the interaction, but H2O2 (oxidative agent) does not have an effect on it. This points out that the interaction takes place through cys residues and is then dependent on the reducing state of the proteins (fig. 2d). map3k5-znf622-4 3 8 enzyme enzyme neutral component neutral component partially purified partially purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q969S3:p.[Cys305Ser;Cys308Ser] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 15:29:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys305ser,cys308ser' Tue Jun 30 18:54:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys305Ser;Cys308Ser]' Mutation in this site decreases phosphorylation. ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 3a left map3k5-znf622-5 3 8 enzyme enzyme neutral component neutral component partially purified partially purified Q99683:p.Lys709Arg mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Wed May 02 17:47:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys709arg' Tue Jun 30 18:10:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys709Arg' Mutation in this site disrupts phosphorylation. ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 3a left map3k5-znf622-6 3 8 enzyme enzyme neutral component neutral component purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 12 enzyme target enzyme target substrate substrate neutral component neutral component purified purified Q969S3:p.Ser314Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:34:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser314ala' Tue Jun 30 17:36:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser314Ala' Putative phosphorylation site. Mutation in this site decreases phosphorylation. Q969S3:p.Thr318Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:45:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr318ala' Tue Jun 30 19:30:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr318Ala' Putative phosphorylation site. Mutation in this site decreases phosphorylation. Q969S3:p.[Ser314Ala;Thr318Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:58:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser314ala,thr318ala' Tue Jun 30 17:35:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser314Ala;Thr318Ala]' Putative phosphorylation site. Mutation in these sites disrupts phosphorylation. Q969S3:p.[Cys305Ser;Cys308Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:39:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys305ser,cys308ser' Tue Jun 30 17:20:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys305Ser;Cys308Ser]' Required for physical interaction. gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 3a left and 3b map3k5-map3k5-2 3 8 putative self putative self putative self putative self partially purified partially purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation true 4a Flag-tagged Znf622 enhanced map3k5 kinase activity. C205S/C308S and S314A/T318A mutants only retained a fraction of this enhancing action. map3k5-txn-1 1 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 6a (right) znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 also decreased the interaction. map3k5-ywhab-2 1 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 6b (right) znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 also decreased the interaction. map3k5-map2k3 1 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 6c (right) znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 increases the interaction. map3k5-txn-2 1 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 6d H2O2 increases the interaction. map3k5-map2k3-2 1 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey association association 6d znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 increases the interaction. map3k5-ywhab-4 1 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey association association 6d znf622 overexpression decreased the interaction in a concentration-dependent manner. znf622 siRNA knock -down had the opposite effect. H2O2 also decreased the interaction. znf622-map3k5-6 4 12 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q969S3:p.Cys308Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:21:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys308ser' Tue Jun 30 17:18:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys308Ser' Q969S3:p.[Cys305Ser;Cys308Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 20:32:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys305ser,cys308ser' Tue Jun 30 18:54:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys305Ser;Cys308Ser]' Q969S3:p.Cys305Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:33:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys305ser' Tue Jun 30 17:36:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys305Ser' 8 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1a and 2b (right) znf622-map3k5-7 4 12 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey c terminal region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2a znf622-map3k5-8 4 8 unspecified role unspecified role prey prey Q99683:p.[Cys1351Ser;Cys1360Ser] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Wed May 02 16:03:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1351ser,cys1360ser' Tue Jun 30 17:47:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys1351Ser;Cys1360Ser]' c terminal region experimental feature experimental feature certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q99683:p.Cys1360Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:37:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1360ser' Tue Jun 30 17:08:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys1360Ser' Q99683:p.Cys1351Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:44:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1351ser' Tue Jun 30 18:43:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys1351Ser' A construct bearing only the C-terminal region of map3k5 is used in this experiment as a basis for all the mutants tested. 12 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2a, 2b (left)