IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. Mol. Cell. Biol. (0270-7306) 2011 imex curation Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2011 Only protein-protein interactions imex curation MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. Mol. Cell. Biol. (0270-7306) 2011 imex curation Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2011 Only protein-protein interactions imex curation MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. Mol. Cell. Biol. (0270-7306) 2011 imex curation Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2011 Only protein-protein interactions imex curation MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. Mol. Cell. Biol. (0270-7306) 2011 imex curation Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl Accepted 2011-SEP-26 by ORCHARD Mol. Cell. Biol. (0270-7306) 2011 Only protein-protein interactions imex curation MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. Mol. Cell. Biol. (0270-7306) 2011 imex curation Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2011 Only protein-protein interactions imex curation Fig7 data are depicted in EBI-4395384 (7a). MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. MICAL-1 Is a Negative Regulator of MST-NDR Kinase Signaling and Apoptosis. Mol. Cell. Biol. (0270-7306) 2011 imex curation Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions mouse-l cells Mus musculus embryo fibroblast, Moloney Sarcoma Virus transformed l cells Mouse embryo fibroblast, Moloney Sarcoma Virus transformed anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou Y., Adolfs Y., Pijnappel W.W., Fuller S.J., Van der Schors R.C., Li K.W., Sugden P.H., Smit A.B., Hergovich A., Pasterkamp R.J. Apoptosis - Interactions involving proteins with a function related to apoptosis r.j.pasterkamp@umcutrecht.nl Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Mol. Cell. Biol. (0270-7306) 2011 Only protein-protein interactions imex curation sept1_mouse Septin-1 Diff6 Differentiation protein 6 Peanut-like protein 3 Pnutl3 Sept1 Septin1 protein protein mouse Mus musculus Mouse MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPDASARTAQTLTIERRGVEIEEGGIKVKLTLVDTPGFGDSVDCSDCWLPVVRFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPRETQALKQKIRDQLKEEEINIYQFPECDSDEDEEFKKQNEEMKENIPFAVVGSCEVVRDGTRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDVL AB619C08D8C74184 stk4_human Serine/threonine-protein kinase 4 STK4 MST1 STE20-like kinase MST1 Mammalian STE20-like protein kinase 1 Serine/threonine-protein kinase Krs-2 KRS2 protein protein human Homo sapiens Human METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF 150758EBC5F77D5C stk38_mouse Serine/threonine-protein kinase 38 Stk38 Ndr1 NDR1 protein kinase Nuclear Dbf2-related kinase 1 protein protein mouse Mus musculus Mouse MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPVSEKAKGLILRFCCEWEHRIGAPGVEEIKNNLFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVTTSSHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK 00E29F8963196750 a4gw50_rat Stk38l rCG_29601 protein protein rat Rattus norvegicus (Rat) Rat MAMTAGATTTFPMSSHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQHARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKADMLEKEQVAHIRAERDILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFIHRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGFPPFCSETPQETYRKVMSWKETLAFPPEVPVSEKAKDLILRFCTDSENRIGNGGVEEIKGHPFFEGVDWGHIRERPAAIPIEIRSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL A4441AA40093AF57 flnb_mouse Filamin-B Flnb ABP-280-like protein Actin-binding-like protein Beta-filamin protein protein mouse Mus musculus Mouse MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMHHKYHQRPTFRQMKLENVSVALEFLDHESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAPGLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKAKLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNKEEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAKGPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQGKNSVELLVEDRGNQVYRCVYKPVQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIRETADFKVDTKAAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFEVQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQNDGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGCTINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAVVWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVGIKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVDPSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDIIDNYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGKDQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTYDGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASGPGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQVGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKVAVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKDGSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLSSCVRACIPQSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQEGKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLATGPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYRGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKLGSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVRESITRTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPVIAPSDDARCLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTGIQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPNHISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP 41BA737EC52A89DB mica1_mouse [F-actin]-monooxygenase MICAL1 Mical1 Mical Nical Molecule interacting with CasL protein 1 NEDD9-interacting protein with calponin homology and LIM domains protein protein mouse Mus musculus Mouse MASPASTNPAHDHFETFVQAQLCQDVLSSFQGLCRALGVESGGGLSQYHKIKAQLNYWSAKSLWAKLDKRASQPVYQQGQACTNTKCLVVGAGPCGLRAAVELALLGARVVLVEKRIKFSRHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVKFTGLQPPPRKGSGWRAQLQPNPPAQLASYEFDVLISAAGGKFVPEGFTIREMRGKLAIGITANFVNGRTVEETQVPEISGVARIYNQKFFQSLLKATGIDLENIVYYKDETHYFVMTAKKQCLLRLGVLRQDLSETDQLLGKANVVPEALQRFARAAADFATHGKLGKLEFAQDARGRPDVAAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMVKRWAEGAGPLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVQDLYDMMDKEHAQRKSDEPDSRKTTTGSAGTEELLHWCQEQTAGFPGVHVTDFSSSWADGLALCALVHHLQPGLLEPSELQGMGALEATTWALRVAEHELGITPVLSAQAVMAGSDPLGLIAYLSHFHSAFKNTSHSSGLVSQPSGTPSAILFLGKLQRSLQRTRAKVDEETPSTEEPPVSEPSMSPNTPELSEHQEAGAEELCELCGKHLYILERFCVDGHFFHRSCFCCHTCEATLWPGGYGQHPGDGHFYCLQHLPQEDQKEADNNGSLESQELPTPGDSNMQPDPSSPPVTRVSPVPSPSQPARRLIRLSSLERLRLSSLNIIPDSGAEPPPKPPRSCSDLARESLKSSFVGWGVPVQAPQVPEAIEKGDDEEEEEEEEEEEEEPLPPLEPELEQTLLTLAKNPGAMTKYPTWRRTLMRRAKEEEMKRFCKAQAIQRRLNEIEATMRELEAEGTKLELALRKESSSPEQQKKLWLDQLLRLIQKKNSLVTEEAELMITVQELDLEEKQRQLDHELRGYMNREETMKTEADLQSENQVLRKLLEVVNQRDALIQFQEERRLREMPA C31A392A4AE222FC mical1-flnb-2 4 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Flag tag was used to inmunoprecipitate mica1 and its interacting partners. n-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey 18 19 association association table 1 mical1-stk38 1 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range Flag tag was used to inmunoprecipitate mica1 and its interacting partners. physical association physical association 1c mical1-stk38-4 2 9 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1d stk38l-mica1 2 10 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range This is NDR2 (serine-threonine kinase 38 like protein). Inferred from similarity with the mouse homolog. 12 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1e mical1-a4gw50-1 5 10 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) This is NDR2 (serine-threonine kinase 38 like protein). Inferred from similarity with the mouse homolog. 12 unspecified role unspecified role bait bait purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c1 fragment sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. direct interaction direct interaction 1f and 1g stk38-mical1-3 6 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 1h mical1-stk38-3 2 12 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range lim region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain c-terminal region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2b and 2c mical1-stk38-2 2 9 unspecified role unspecified role prey prey c-terminal region sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal hm region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2e and 2f stk38-mical1 2 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5a and 5b Binding of mical1 reduces phosphorylation of ndr1. stk38-mical1-2 2 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range association association 7a Binding of mical1 reduces phosphorylation of ndr1 (fig. 7b). mical1-stk38-5 6 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 1h stk38l-stk38l-2 3 10 putative self putative self putative self putative self purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true 4b Autophosphorylation of stk38l (NDR2). stk4-1 3 8 putative self putative self putative self putative self purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true 6c Autophosphorylation of stk4 (MST1). stk38-stk4 3 9 enzyme target enzyme target substrate substrate unspecified role unspecified role partially purified partially purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 This is a kinase-dead form of stk38 (NDR1). 8 enzyme enzyme unspecified role unspecified role purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 6c Autophosphorylation of STK38 (NDR1) Stk38 is kinase-dead.