InnateDB InnateDB Perforin pores in the endosomal membrane trigger the release of endocytosed granzyme B into the cytosol of target cells. Perforin pores in the endosomal membrane trigger the release of endocytosed granzyme B into the cytosol of target cells. Nat. Immunol. (1529-2908) 2011 imex curation Thiery J., Keefe D., Boulant S., Boucrot E., Walch M., Martinvalet D., Goping I.S., Bleackley R.C., Kirchhausen T., Lieberman J. Apoptosis - Interactions involving proteins with a function related to apoptosis lieberman@idi.harvard.edu species of EEA-1 and Rab5 determined via author correspondence 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Thiery J., Keefe D., Boulant S., Boucrot E., Walch M., Martinvalet D., Goping I.S., Bleackley R.C., Kirchhausen T., Lieberman J. Apoptosis - Interactions involving proteins with a function related to apoptosis lieberman@idi.harvard.edu species of EEA-1 and Rab5 determined via author correspondence Accepted 2011-AUG-04 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity Perforin pores in the endosomal membrane trigger the release of endocytosed granzyme B into the cytosol of target cells. Perforin pores in the endosomal membrane trigger the release of endocytosed granzyme B into the cytosol of target cells. Nat. Immunol. (1529-2908) 2011 imex curation Thiery J., Keefe D., Boulant S., Boucrot E., Walch M., Martinvalet D., Goping I.S., Bleackley R.C., Kirchhausen T., Lieberman J. Apoptosis - Interactions involving proteins with a function related to apoptosis lieberman@idi.harvard.edu species of EEA-1 and Rab5 determined via author correspondence 23-Sept-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells comigration in gel comigration in gel electrophoresis comigration in gel western blot western blot Immuno blot Immuno blot Thiery J., Keefe D., Boulant S., Boucrot E., Walch M., Martinvalet D., Goping I.S., Bleackley R.C., Kirchhausen T., Lieberman J. Apoptosis - Interactions involving proteins with a function related to apoptosis lieberman@idi.harvard.edu species of EEA-1 and Rab5 determined via author correspondence Accepted 2011-AUG-04 by ORCHARD 23-Sept-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity rabx5_human Rab5 GDP/GTP exchange factor Rabex-5 Rabaptin-5-associated exchange factor for Rab5 RAP1 RABGEF1 RABEX5 protein protein human Homo sapiens Human MSLKSERRGIHVDQSDLLCKKGCGYYGNPAWQGFCSKCWREEYHKARQKQIQEDWELAERLQREEEEAFASSQSSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSASSRVGSKKEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKLFLEGMHYKRDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPLQPQVYAG 49ACABA276E65E91 perf_human Perforin-1 Lymphocyte pore-forming protein Cytolysin PRF1 PFP protein protein human Homo sapiens Human MAARLLLLGILLLLLPLPVPAPCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFPVDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARDAARSIRNDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRALGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALRTCELALEGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW DIP protein P14222 original sequence version: 124 DDEDE0D1CAB7586E grab_human Granzyme B GZMB CGL1 CSPB CTLA1 GRB Granzyme-2 T-cell serine protease 1-3E Cytotoxic T-lymphocyte proteinase 2 SECT Cathepsin G-like 1 CTLA-1 Fragmentin-2 Human lymphocyte protein C11 protein protein human Homo sapiens Human MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY C652271918EF24F9 eea1_human Early endosome antigen 1 EEA1 ZFYVE2 Endosome-associated protein p162 Zinc finger FYVE domain-containing protein 2 protein protein human Homo sapiens Human MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTRLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNELTQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSLHRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTELQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG 51BA418F561E3411 prf1-prf1 2 4 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 3G, S5D oligomer band migrated at ~420kDa, which is the estimated weight of a hepatmer. A larger band was also observed, suggesting the formation of a larger multimer. eea1-gzmb 1 6 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region alexa label alexa label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 4A. rat perforin eea1-rabx5 1 6 unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component p.Ser34Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Authors report mutation in this position, but sequence in UniProt does not have a Ser in position 34. Q9UJ41:p.Gln79Leu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:00:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala79leu' Tue Jun 30 17:12:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln79Leu' colocalization colocalization Fig. S2A rat perforin Co-transfection of HeLa cells with EGFP-Rab5(Q79L) and mRFP-EEA1 results in enlarged endosomes.