IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Cell (0092-8674) 2011 imex curation Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Cell (0092-8674) 2011 imex curation Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Cell (0092-8674) 2011 imex curation Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Figure legend added to EBI-4304967 Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Cell (0092-8674) 2011 imex curation Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation EBI-4305010 - has Fig 2C entered, but interactors are wrong. > Corrected to Fig. 6E EBI-4304649 - also with Fig 2C - has a mutation entered for HIF1A - which I cannot see should be there. > Label corrected to 4H (mutant I think is correct). I cannot find Fig 4H anywhere, nor Fig 5G, nor Fig 6E. > 5G added to EBI-4304649 Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Cell (0092-8674) 2011 imex curation Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation Mutation added Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Cell (0092-8674) 2011 imex curation Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation All added Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Pyruvate Kinase M2 Is a PHD3-Stimulated Coactivator for Hypoxia-Inducible Factor 1. Cell (0092-8674) 2011 imex curation Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Luo W., Hu H., Chang R., Zhong J., Knabel M., O'Meally R., Cole R.N., Pandey A., Semenza G.L. Apoptosis - Interactions involving proteins with a function related to apoptosis HEK293 lysate prepared from HEK293 cells grown in media containing light isotopes (12C6-14N2-Lys and 12C6-14N4-Arg) or heavy isotopes (13C6-15N2-Lys and 13C6-15N4-Arg), respectively. The precipitated proteins were analyzed by Q-TOF mass spectrometry Origin of HIF1A inferred from sequence length given in PMID: 15721254. gsemenza@jhmi.edu Accepted 2011-AUG-30 by MGT 23-Sept-2011: Contacted by JYOTI. Cell (0092-8674) 2011 mgt Only protein-protein interactions imex curation vegfa_human_gene Human VEGFA gene gene gene human Homo sapiens Human arnt_human Aryl hydrocarbon receptor nuclear translocator ARNT Dioxin receptor, nuclear translocator Hypoxia-inducible factor 1-beta BHLHE2 Class E basic helix-loop-helix protein 2 protein protein human Homo sapiens Human MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE DIP protein P27540 original sequence version: 118 DIP protein P27540 original sequence version: 160 DIP protein P27540-1 original sequence version: 160 2E278F8E62BFBF6D egln1_human Egl nine homolog 1 EGLN1 C1orf12 PNAS-118 PNAS-137 Hypoxia-inducible factor prolyl hydroxylase 2 Prolyl hydroxylase domain-containing protein 2 SM-20 protein protein human Homo sapiens Human MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGAREPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF 81A97FF772CAA14C p14618-1 Pyruvate kinase PKM M2-PK PKM2 PKM Cytosolic thyroid hormone-binding protein OIP3 Opa-interacting protein 3 PK2 PK3 PKM2 Pyruvate kinase 2/3 Pyruvate kinase muscle isozyme Thyroid hormone-binding protein 1 Tumor M2-PK p58 protein protein human Homo sapiens Human MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP DIP protein P14618-1 original sequence version: 162 DIP protein P14618-1 original sequence version: 173 AA94D7818ED6BBAD kpym_human_gene Human KPYM gene gene gene human Homo sapiens Human kpym_human Pyruvate kinase PKM PKM Cytosolic thyroid hormone-binding protein OIP3 Opa-interacting protein 3 PK2 PK3 PKM2 Pyruvate kinase 2/3 Pyruvate kinase muscle isozyme Thyroid hormone-binding protein 1 Tumor M2-PK p58 protein protein human Homo sapiens Human MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP DIP protein P14618 original sequence version: 162 AA94D7818ED6BBAD hif1a_human Hypoxia-inducible factor 1-alpha ARNT-interacting protein Member of PAS protein 1 Basic-helix-loop-helix-PAS protein MOP1 HIF1A MOP1 BHLHE78 PASD8 PAS domain-containing protein 8 Class E basic helix-loop-helix protein 78 protein protein human Homo sapiens Human MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN DIP protein Q16665 original sequence version: 94 DIP protein Q16665 original sequence version: 98 DIP protein Q16665-1 original sequence version: 102 DIP protein Q16665 original sequence version: 102 DIP protein Q16665 original sequence version: 127 DIP protein Q16665 original sequence version: 120 DIP protein Q16665 original sequence version: 169 DIP protein Q16665 original sequence version: 174 DIP protein Q16665-1 original sequence version: 174 DIP protein Q16665-1 original sequence version: 191 DIP protein Q16665 original sequence version: 191 DIP protein Q16665 original sequence version: 179 DIP protein Q16665 original sequence version: 150 DIP protein Q16665 original sequence version: 156 DIP protein Q16665 original sequence version: 177 ABD4F7DAA135BE2D egln3_human Prolyl hydroxylase EGLN3 Hypoxia-inducible factor prolyl hydroxylase 3 HPH-1 Prolyl hydroxylase domain-containing protein 3 EGLN3 Egl nine homolog 3 protein protein human Homo sapiens Human MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED 9DA3A0F80168557B epas1_human Endothelial PAS domain-containing protein 1 EPAS1 HIF2A MOP2 Member of PAS protein 2 Basic-helix-loop-helix-PAS protein MOP2 BHLHE73 PASD2 Hypoxia-inducible factor 2-alpha HIF-1-alpha-like factor PAS domain-containing protein 2 Class E basic helix-loop-helix protein 73 protein protein human Homo sapiens Human MTADKEKKRSSSERRKEKSRDAARCRRSKETEVFYELAHELPLPHSVSSHLDKASIMRLAISFLRTHKLLSSVCSENESEAEADQQMDNLYLKALEGFIAVVTQDGDMIFLSENISKFMGLTQVELTGHSIFDFTHPCDHEEIRENLSLKNGSGFGKKSKDMSTERDFFMRMKCTVTNRGRTVNLKSATWKVLHCTGQVKVYNNCPPHNSLCGYKEPLLSCLIIMCEPIQHPSHMDIPLDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFGNQNFEESSAYGKAILPPSQPWATELRSHSTQSEAGSLPAFTVPQAAAPGSTTPSATSSSSSCSTPNSPEDYYTSLDNDLKIEVIEKLFAMDTEAKDQCSTQTDFNELDLETLAPYIPMDGEDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGGRSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLPQPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFESYLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT DIP protein Q99814 original sequence version: 115 DIP protein Q99814 original sequence version: 155 DIP protein Q99814 original sequence version: 157 DIP protein Q99814 original sequence version: 137 DIP protein Q99814 original sequence version: 135 4838989598234FC1 prpk_human_gene TP53RK/PRPK Human gene gene gene human Homo sapiens Human ldha_human_gene Human L-lactate dehydrogenase A chain gene gene gene human Homo sapiens Human ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB hif1a-pkm2-4 7 11 unspecified role unspecified role prey prey region isotope label isotope label undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2A hif1a-pkm2-5 2 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Fig. 2B hif1a-pkm2-6 4 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P14618-1:p.[Pro403Ala;Pro408Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Tue Jun 30 18:12:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro403Ala;Pro408Ala]' 14 unspecified role unspecified role bait bait physical association physical association Figs. 4H, 5G hif1a-pkm2-7 1 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 14 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig. 2D and 2E epas1-pkm2 4 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 2F pkm2-hif1a 3 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined e10 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 51 48 physical association physical association Fig. 3J hif1a-pkm2-8 5 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16665:p.[Pro402Ala;Pro564Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 17:07:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564ala' Tue Jun 30 18:53:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Ala]' physical association physical association Fig. 4J Dimethyloxalylglycine (DMOG) hif1a-pkm2-9 5 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16665:p.[Pro402Ala;Pro564Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 20:32:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro402ala,pro564ala' Tue Jun 30 16:58:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro402Ala;Pro564Ala]' 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5F, Supp Fig. 4D PHD3 overexpression enhanced the interaction of PKM2 with HIF1αA(P402A/P564A) but did not stimulate the interaction between PKM2(P403/408A) and HIF1A(P402A/P564A) egln1-pkm2 2 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 4F egln3-pkm2 4 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait physical association physical association Fig. 5A pkm2-egln3-1 3 11 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined e10 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association Fig. 5B, Supp Fig. 4A hif1a-ldha 6 14 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey association association Fig. 6A hif1a-pdk1 6 14 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association Supp. Fig. 5A arnt-ldha 6 18 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Fig. 6B arnt-pdk1 6 17 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association Supp. Fig. 5B ep300-pkm2 4 19 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.6E ep300-ldha 6 19 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey association association Fig. 6F hif1a-arnt-2 2 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 5C, S5D hif1a-vegfa 6 14 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey association association Supp. Fig. 5E pkm2-pdk1 6 17 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Supp. Fig. 5F egln3-pdk1 6 17 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait association association Supp. Fig. 5G hif1a-kpym 6 12 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association Fig. 1D Binding was shown to the candidate HRE, which was found within the first intron on the antisense strand. egln3-ldha 6 18 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait association association Fig. 6D pkm2-ldha 6 18 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait association association Fig. 6C epas1-hif1a 6 8 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association Supp. Fig. 5E