IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ FTH1 binds to Daxx and inhibits Daxx-mediated cell apoptosis. FTH1 binds to Daxx and inhibits Daxx-mediated cell apoptosis. Mol. Biol. Rep. (0301-4851) 2011 imex curation Liu F., Du Z.Y., He J.L., Liu X.Q., Yu Q.B., Wang Y.X. Apoptosis - Interactions involving proteins with a function related to apoptosis wyx61221@yahoo.com.cn 23-Sept-2011: Contacted by JYOTI. Adult human liver cDNA mgt Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu F., Du Z.Y., He J.L., Liu X.Q., Yu Q.B., Wang Y.X. Apoptosis - Interactions involving proteins with a function related to apoptosis wyx61221@yahoo.com.cn Accepted 2011-AUG-18 by MGT 23-Sept-2011: Contacted by JYOTI. Adult human liver cDNA Mol. Biol. Rep. (0301-4851) 2011 mgt Only protein-protein interactions imex curation FTH1 binds to Daxx and inhibits Daxx-mediated cell apoptosis. FTH1 binds to Daxx and inhibits Daxx-mediated cell apoptosis. Mol. Biol. Rep. (0301-4851) 2011 imex curation Liu F., Du Z.Y., He J.L., Liu X.Q., Yu Q.B., Wang Y.X. Apoptosis - Interactions involving proteins with a function related to apoptosis wyx61221@yahoo.com.cn 23-Sept-2011: Contacted by JYOTI. Adult human liver cDNA mgt Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu F., Du Z.Y., He J.L., Liu X.Q., Yu Q.B., Wang Y.X. Apoptosis - Interactions involving proteins with a function related to apoptosis wyx61221@yahoo.com.cn Accepted 2011-AUG-18 by MGT 23-Sept-2011: Contacted by JYOTI. Adult human liver cDNA Mol. Biol. Rep. (0301-4851) 2011 mgt Only protein-protein interactions imex curation FTH1 binds to Daxx and inhibits Daxx-mediated cell apoptosis. FTH1 binds to Daxx and inhibits Daxx-mediated cell apoptosis. Mol. Biol. Rep. (0301-4851) 2011 imex curation Liu F., Du Z.Y., He J.L., Liu X.Q., Yu Q.B., Wang Y.X. Apoptosis - Interactions involving proteins with a function related to apoptosis wyx61221@yahoo.com.cn 23-Sept-2011: Contacted by JYOTI. Adult human liver cDNA mgt Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Liu F., Du Z.Y., He J.L., Liu X.Q., Yu Q.B., Wang Y.X. Apoptosis - Interactions involving proteins with a function related to apoptosis wyx61221@yahoo.com.cn Accepted 2011-AUG-18 by MGT 23-Sept-2011: Contacted by JYOTI. Adult human liver cDNA Mol. Biol. Rep. (0301-4851) 2011 mgt Only protein-protein interactions imex curation frih_human Ferritin heavy chain Cell proliferation-inducing gene 15 protein FTH1 FTH FTHL6 PIG15 OK/SW-cl.84 protein protein human Homo sapiens Human MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES DIP protein P02794 original sequence version: 140 FEF75640A29CCF56 spop_human Speckle-type POZ protein HIB homolog 1 Roadkill homolog 1 SPOP protein protein human Homo sapiens Human MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS DIP protein O43791 original sequence version: 150 EE5F4C5CF6FD09DC btbd6_human BTB/POZ domain-containing protein 6 BTBD6 BDPL Lens BTB domain protein protein protein human Homo sapiens Human MAAELYAPASAAAADLANSNAGAAVGRKAGPRSPPSAPAPAPPPPAPAPPTLGNNHQESPGWRCCRPTLRERNALMFNNELMADVHFVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAAFLILLKYMYSDEIDLEADTVLATLYAAKKYIVPALAKACVNFLETSLEAKNACVLLSQSRLFEEPELTQRCWEVIDAQAEMALRSEGFCEIDRQTLEIIVTREALNTKEAVVFEAVLNWAEAECKRQGLPITPRNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTLEETHSIFLWYTATNKPRLDFPLTKRKGLAPQRCHRFQSSAYRSNQWRYRGRCDSIQFAVDRRVFIAGLGLYGSSSGKAEYSVKIELKRLGVVLAQNLTKFMSDGSSNTFPVWFEHPVQVEQDTFYTASAVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTGVQGGQIPELIFYA B6D984D25DDD843B daxx_human Death domain-associated protein 6 DAXX BING2 DAP6 Daxx Fas death domain-associated protein ETS1-associated protein 1 protein protein human Homo sapiens Human MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVDPALSDPVLARRLRENRSLAMSRLDEVISKYAMLQDKSEEGERKKRRARLQGTSSHSADTPEASLDSGEGPSGMASQGCPSASRAETDDEDDEESDEEEEEEEEEEEEEATDSEEEEDLEQMQEGQEDDEEEDEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSGPPCKKSRKEKKQTGSGPLGNSYVERQRSVHEKNGKKICTLPSPPSPLASLAPVADSSTRVDSPSHGLVTSSLCIPSPARLSQTPHSQPPRPGTCKTSVATQCDPEEIIVLSDSD 1B309ADDAA878040 daxx-fth1-1 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 1 daxx-spop-1 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 1 daxx-btbd6 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Table 1 fth1-daxx 3 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Discrepancy between Materials and Methods and figure legend - DAXX may have been purified prior to interaction. Fig. 2B daxx-fth1-2 2 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3A fth1-daxx-1 2 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3A