IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. J. Biol. Chem. (0021-9258) 2011 imex curation Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells confocal microscopy confocal microscopy immunostaining immunostaining Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn Accepted 2012-JAN-23 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. J. Biol. Chem. (0021-9258) 2011 imex curation Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay autoradiography autoradiography Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn Accepted 2012-JAN-23 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. J. Biol. Chem. (0021-9258) 2011 imex curation Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn Accepted 2012-JAN-23 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. J. Biol. Chem. (0021-9258) 2011 imex curation Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn Accepted 2012-JAN-23 by ORCHARD J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. Phosphorylation of caspase-7 by p21-activated protein kinase (PAK) 2 inhibits chemotherapeutic drug-induced apoptosis of breast cancer cell lines. J. Biol. Chem. (0021-9258) 2011 imex curation Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Li X., Wen W., Liu K., Zhu F., Malakhova M., Peng C., Li T., Kim H.G., Ma W., Cho Y.Y., Bode A.M., Dong Z., Dong Z. Apoptosis - Interactions involving proteins with a function related to apoptosis The phosphorylation was detected in parallel with antibodies that could ascertain Thr- and Ser-specific phosphorylation. Origin of CASP7 inferred from sequence used to predict phosphorylation sites. dongzm@zzu.edu.cn Accepted 2012-JAN-23 by ORCHARD 14-Mar-2012: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation pak2_human Serine/threonine-protein kinase PAK 2 p21-activated kinase 2 Gamma-PAK PAK65 S6/H4 kinase p58 PAK2 protein protein human Homo sapiens Human MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR DIP protein Q13177 original sequence version: 166 DIP protein Q13177 original sequence version: 114 00A7CD15F93D4180 casp7_human Caspase-7 ICE-like apoptotic protease 3 Apoptotic protease Mch-3 CMH-1 CASP7 MCH3 protein protein human Homo sapiens Human MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ DIP protein P55210 original sequence version: 92 DIP protein P55210 original sequence version: 114 DIP protein P55210 original sequence version: 118 CD373EE54A232CA4 pak2-casp7 4 6 unspecified role unspecified role bait bait v5 tag v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2a pak2-casp7-1 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 2b casp7-pak2-4 1 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 2c The colocalization is detected in cytoplasm. Upon treatment with staurosporine (induces apoptosis), the colocalization is restricted to the nucleus. casp7-pak2-1 2 7 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified P55210:p.[Ser30Ala;Thr173Ala;Ser239Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:55:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser30ala,thr173ala,ser239ala' Tue Jun 30 19:39:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ser30Ala;Thr173Ala;Ser239Ala]' his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 enzyme enzyme unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 26 24 phosphorylation phosphorylation reaction phosphorylation 2d and 3d casp7-pak2-2 5 6 enzyme enzyme unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 3a casp7-pak2-3 2 6 enzyme enzyme unspecified role unspecified role purified purified t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 enzyme target enzyme target substrate substrate unspecified role unspecified role purified purified peptide phosphorylation site ser239 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain peptide phosphorylation site thr173 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain peptide phosphorylation site ser30 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) phosphorylation phosphorylation reaction phosphorylation 3c and 3b pak2-pak2-10 2 6 putative self putative self putative self putative self purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range t7 tag t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation true 3d