IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Neurosteroid dehydroepiandrosterone interacts with nerve growth factor (NGF) receptors, preventing neuronal apoptosis. Neurosteroid dehydroepiandrosterone interacts with nerve growth factor (NGF) receptors, preventing neuronal apoptosis. PLoS Biol. (1544-9173) 2011 imex curation Lazaridis I., Charalampopoulos I., Alexaki V.I., Avlonitis N., Pediaditakis I., Efstathopoulos P., Calogeropoulou T., Castanas E., Gravanis A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origins of TRAF6, RIPK2 and ARHGDIA were given by the authors upon email request. gravanis@med.uoc.gr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Lazaridis I., Charalampopoulos I., Alexaki V.I., Avlonitis N., Pediaditakis I., Efstathopoulos P., Calogeropoulou T., Castanas E., Gravanis A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origins of TRAF6, RIPK2 and ARHGDIA were given by the authors upon email request. gravanis@med.uoc.gr Accepted 2011-OCT-24 by ORCHARD 21-Dec-2011: Contacted by JYOTI. PLoS Biol. (1544-9173) 2011 Only protein-protein interactions imex curation Neurosteroid dehydroepiandrosterone interacts with nerve growth factor (NGF) receptors, preventing neuronal apoptosis. Neurosteroid dehydroepiandrosterone interacts with nerve growth factor (NGF) receptors, preventing neuronal apoptosis. PLoS Biol. (1544-9173) 2011 imex curation Lazaridis I., Charalampopoulos I., Alexaki V.I., Avlonitis N., Pediaditakis I., Efstathopoulos P., Calogeropoulou T., Castanas E., Gravanis A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origins of TRAF6, RIPK2 and ARHGDIA were given by the authors upon email request. gravanis@med.uoc.gr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Lazaridis I., Charalampopoulos I., Alexaki V.I., Avlonitis N., Pediaditakis I., Efstathopoulos P., Calogeropoulou T., Castanas E., Gravanis A. Apoptosis - Interactions involving proteins with a function related to apoptosis The origins of TRAF6, RIPK2 and ARHGDIA were given by the authors upon email request. gravanis@med.uoc.gr Accepted 2011-OCT-24 by ORCHARD PLoS Biol. (1544-9173) 2011 Only protein-protein interactions imex curation traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV DIP protein Q9Y4K3 original sequence version: 154 DIP protein Q9Y4K3 original sequence version: 91 DIP protein Q9Y4K3 original sequence version: 114 DIP protein Q9Y4K3 original sequence version: 118 DIP protein Q9Y4K3 original sequence version: 140 DIP protein Q9Y4K3 original sequence version: 159 DIP protein Q9Y4K3 original sequence version: 132 DIP protein Q9Y4K3 original sequence version: 158 DIP protein Q9Y4K3 original sequence version: 171 DIP protein Q9Y4K3 original sequence version: 117 DIP protein Q9Y4K3 original sequence version: 113 5AB9C255CCFEE749 gdir1_human Rho GDP-dissociation inhibitor 1 Rho-GDI alpha ARHGDIA GDIA1 protein protein human Homo sapiens Human MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD 59CB6F42E3B3BCCA ntrk1_rat High affinity nerve growth factor receptor Neurotrophic tyrosine kinase receptor type 1 p140-TrkA Slow nerve growth factor receptor Ntrk1 Trk Trka protein protein rat Rattus norvegicus (Rat) Rat MLRGQRHGQLGWHRPAAGLGGLVTSLMLACACAASCRETCCPVGPSGLRCTRAGTLNTLRGLRGAGNLTELYVENQRDLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFHFTPRLSHLNLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALLWLQRWEQEDLCGVYTQKLQGSGSGDQFLPLGHNNSCGVPSVKIQMPNDSVEVGDDVFLQCQVEGQALQQADWILTELEGTATMKKSGDLPSLGLTLVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGKAVEQHHWCIPFSVDGQPAPSLRWFFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNGNYTLLAANPYGQAAASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSRDPVEKKDETPFGVSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQDKMLVAVKALKETSENARQDFHREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDVHARLQALAQAPPSYLDVLG DIP protein P35739 original sequence version: 73 DIP protein P35739 original sequence version: 108 D564E8801E8978F8 dhea-7-cmo Dehydroepiandrosterone-7-O-(carboxymethyl)oxime small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tnr16_rat Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low-affinity nerve growth factor receptor Gp80-LNGFR p75 ICD Low affinity neurotrophin receptor p75NTR protein protein rat Rattus norvegicus (Rat) Rat MRRAGAACSAMDRLRLLLLLILGVSSGGAKETCSTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDNVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCAYGYYQDEETGHCEACSVCEVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWIPRSTPPEGSDSTAPSTQEPEVPPEQDLVPSTVADMVTTVMGSSQPVVTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV DIP protein P07174 original sequence version: 124 DIP protein P07174 original sequence version: 106 B2E152D94D3827F8 ripk2_human Receptor-interacting serine/threonine-protein kinase 2 RIPK2 CARDIAK RICK RIP2 UNQ277/PRO314/PRO34092 RIP-like-interacting CLARP kinase Receptor-interacting protein 2 CARD-containing interleukin-1 beta-converting enzyme-associated kinase Tyrosine-protein kinase RIPK2 protein protein human Homo sapiens Human MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQLHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIINPLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM DIP protein O43353 original sequence version: 159 DIP protein O43353-1 original sequence version: 116 DIP protein O43353 original sequence version: 116 575A692239505792 tnr16_mouse Tumor necrosis factor receptor superfamily member 16 Ngfr Tnfrsf16 Low affinity neurotrophin receptor p75NTR Low-affinity nerve growth factor receptor protein protein mouse Mus musculus Mouse MRRAGAACSAMDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSYGYYQDEETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVCEDTERQLRECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVMGSSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEVEKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQRADIVESLCSESTATSPV 7AC73263F7B31436 dhea_7_cmo-ntrk1-1 2 5 unspecified role unspecified role prey prey purified purified extracellular domain sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 4a Free DHEA (CHEBI:16814) or NGF (Nerve Growth Factor) can disrupt the interaction. dhea_7_cmo-ngfr-1 2 6 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey purified purified extracellular domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4a Free DHEA (CHEBI:16814) or NGF (Nerve Growth Factor) can disrupt the interaction. dhea_7_cmo-ntrk1-3 2 6 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 4b dhea_7_cmo-ngfr-2 2 7 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 6 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 4b dhea_7_cmo-ngfr-3 2 6 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 5 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 4b dhea_7_cmo-ngfr-4 2 5 unspecified role unspecified role prey prey cell lysate cell lysate rat-brain Rattus norvegicus brain brain Brain [cerebrum] 6 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role prey prey cell lysate cell lysate rat-brain Rattus norvegicus brain brain Brain [cerebrum] physical association physical association 4c dhea_7_cmo-ngfr-5 2 7 unspecified role unspecified role prey prey cell lysate cell lysate rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells 5 unspecified role unspecified role prey prey cell lysate cell lysate rat-pc12 Rattus norvegicus PC12 cells pc12 Rat adrenal pheochromocytoma cells 6 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 4c traf6-ngfr 1 3 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5b arhgdia-ngfr 1 4 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5b ripk2-ngfr 1 8 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 5b