IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. J. Biol. Chem. (0021-9258) 2011 imex curation Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-rl Homo sapiens rl human B cell lymphoma RL cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu Accepted 2011-AUG-18 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. J. Biol. Chem. (0021-9258) 2011 imex curation Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 pull down pull down western blot western blot Immuno blot Immuno blot Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu Accepted 2011-AUG-18 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. J. Biol. Chem. (0021-9258) 2011 imex curation Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu Accepted 2011-AUG-18 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. Noxa/Bcl-2 protein interactions contribute to bortezomib resistance in human lymphoid cells. J. Biol. Chem. (0021-9258) 2011 imex curation Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu 23-Sept-2011: Contacted by JYOTI. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia pull down pull down western blot western blot Immuno blot Immuno blot Smith A.J., Dai H., Correia C., Takahashi R., Lee S.H., Schmitz I., Kaufmann S.H. Apoptosis - Interactions involving proteins with a function related to apoptosis Kaufmann.scott@mayo.edu Accepted 2011-AUG-18 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB p10415-1 Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK 3C49F2B714DC9CCB mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F apr_human Phorbol-12-myristate-13-acetate-induced protein 1 NOXA Immediate-early-response protein APR PMAIP1 Protein Noxa protein protein human Homo sapiens Human MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT 291A142B27167E70 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE pmaip1-bcl2-2 3 8 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range s-peptide tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey purified purified P10415-1:p.[Pro59Thr;Ser117Arg] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P T certain certain sequence position certain certain certain sequence position certain S R Wed May 02 15:38:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro59thr,ser117arg' Tue Jun 30 18:16:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro59Thr;Ser117Arg]' About 45e-8M, inferred from graphical representation (fig. 1e). gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P10415-1:p.[Asp31His;Ala60Val] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D H certain certain sequence position certain certain certain sequence position certain A V Wed May 02 16:23:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp31his,ala60val' Tue Jun 30 17:04:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp31His;Ala60Val]' 11e-9M P10415-1:p.[Ile48Phe;Arg129Cys] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I F certain certain sequence position certain certain certain sequence position certain R C Wed May 02 19:24:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile48phe,arg129cys' Tue Jun 30 18:47:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile48Phe;Arg129Cys]' About 15e-8M (inferred from graph, fig 1e). ecoli Escherichia coli (strain K12) direct interaction direct interaction 1b, 1d, s1b, S1c and 1e pmaip1-mcl1-6 3 8 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range s-peptide tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 1a pmaip1-bcl2l1 3 8 unspecified role unspecified role bait bait purified purified s-peptide tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction S1a pmaip1-bcl2-1 3 8 unspecified role unspecified role bait bait purified purified bh3 domain containing region sufficient to bind sufficient binding region sufficient to bind exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P10415-1:p.Arg146Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Wed May 02 20:10:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg146ala' Tue Jun 30 19:44:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg146Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction 2a and 2d bcl2-pmaip1 4 6 unspecified role unspecified role bait bait P10415-1:p.[Asp31His;Ala60Val] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D H certain certain sequence position certain certain certain sequence position certain A V Wed May 02 18:07:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp31his,ala60val' Tue Jun 30 18:58:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp31His;Ala60Val]' s-peptide tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey physical association physical association 3c and 3e Proteasome-inhibitor bortemozid is required for the interaction to take place. pmaip1-bcl2-1 4 5 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait s-peptide tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3d Proteasome inhibitor MG132 is required for the interaction to take place. bcl2-pmaip1-1 1 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 3f bcl2-pmaip1-2 2 5 unspecified role unspecified role bait bait s-peptide tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role prey prey physical association physical association 3g (right) Camptothecin, a topoisomerase I poison that induces apoptosis, was required for the interaction to take place. mcl1-pmaip1 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait s-peptide tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 3g (left) Camptothecin, a topoisomerase I poison that induces apoptosis, was required for the interaction to take place.