IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Cancer Res. (0008-5472) 2011 imex curation Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Affinomics - Interactions curated for the Affinomics consortium. Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-rg37 RG37 SV40-immortalized human fibroblasts (derived from GM639 and transfected with pDR-GFP plasmid). rg37 RG37 SV40-immortalized human fibroblasts (derived from GM639 and transfected with pDR-GFP plasmid). pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Accepted 2013-SEP-24 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Cancer Res. (0008-5472) 2011 imex curation Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Affinomics - Interactions curated for the Affinomics consortium. Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Accepted 2013-SEP-24 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Cancer Res. (0008-5472) 2011 imex curation Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Affinomics - Interactions curated for the Affinomics consortium. Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-rg37 RG37 SV40-immortalized human fibroblasts (derived from GM639 and transfected with pDR-GFP plasmid). rg37 RG37 SV40-immortalized human fibroblasts (derived from GM639 and transfected with pDR-GFP plasmid). confocal microscopy confocal microscopy immunostaining immunostaining Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Accepted 2013-SEP-24 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Cancer Res. (0008-5472) 2011 imex curation Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Affinomics - Interactions curated for the Affinomics consortium. Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-crl_2261 CRL-2261 human B-lymphoblastoid cell line (derived from non-Hodgkin's lymphoma) crl_2261 CRL-2261 human B lymphoblastoid cell line (derived from non-Hodgkin's lymphoma). pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Accepted 2013-SEP-24 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Cancer Res. (0008-5472) 2011 imex curation Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Affinomics - Interactions curated for the Affinomics consortium. Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-priess Homo sapiens priess Priess EBV-transformed human lymphoblastoid cell line pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Accepted 2013-SEP-24 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Bcl-2 inhibits nuclear homologous recombination by localizing BRCA1 to the endomembranes. Cancer Res. (0008-5472) 2011 imex curation Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Affinomics - Interactions curated for the Affinomics consortium. Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Laulier C., Barascu A., Guirouilh-Barbat J., Pennarun G., Le Chalony C., Chevalier F., Palierne G., Bertrand P., Verbavatz J.M., Lopez B.S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BRCA1 construct could not be ascertained, so interactions depicted in figures 7a and 7b could not be curated. bernard.lopez@cea.fr Accepted 2013-SEP-24 by MGT 30-Sept-2013: Contacted by IntAct-Help. Cancer Res. (0008-5472) 2011 Only protein-protein interactions imex curation bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB brca1_human Breast cancer type 1 susceptibility protein BRCA1 RNF53 RING finger protein 53 RING-type E3 ubiquitin transferase BRCA1 protein protein human Homo sapiens Human MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSLSVQLSNLGTVRTLRTKQRIQPQKTSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTRDEISLDSAKKAACEFSETDVTNTEHHQPSNNDLNTTEKRAAERHPEKYQGSSVSNLHVEPCGTNTHASSLQHENSSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRRTPSTEKKVDLNADPLCERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGESESNAKVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAVQKTPEMINQGTNQTEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPISSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSSEEIKKKKYNQMPVRHSRNLQLMEGKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPGSFTKCSNTSELKEFVNPSLPREEKEEKLETVKVSNNAEDPKDLMLSGERVLQTERSVESSSISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKGLIHGCSKDNRNDTEGFKYPLGHEVNHSRETSIEMEESELDAQYLQNTFKVSKRQSFAPFSNPGNAEEECATFSAHSGSLKKQSPKVTFECEQKEENQGKNESNIKPVQTVNITAGFPVVGQKDKPVDNAKCSIKGGSRFCLSSQFRGNETGLITPNKHGLLQNPYRIPPLFPIKSFVKTKCKKNLLEENFEEHSMSPEREMGNENIPSTVSTISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEIGSSDENIQAELGRNRGPKLNAMLRLGVLQPEVYKQSLPGSNCKHPEIKKQEYEEVVQTVNTDFSPYLISDNLEQPMGSSHASQVCSETPDDLLDDGEIKEDTSFAENDIKESSAVFSKSVQKGELSRSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVNNIPSQSTRHSTVATECLSKNTEENLLSLKNSLNDCSNQVILAKASQEHHLSEETKCSASLFSSQCSELEDLTANTNTQDPFLIGSSKQMRHQSESQGVGLSDKELVSDDEERGTGLEENNQEEQSMDSNLGEAASGCESETSVSEDCSGLSSQSDILTTQQRDTMQHNLIKLQQEMAELEAVLEQHGSQPSNSYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTSKNKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNRNYPSQEELIKVVDVEEQQLEESGPHDLTETSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESARVGNIPSSTSALKVPQLKVAESAQSPAAAHTTDTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPHSHY DIP protein P38398 original sequence version: 183 DIP protein P38398 original sequence version: 111 DIP protein P38398 original sequence version: 149 DIP protein P38398-1 original sequence version: 149 DIP protein P38398 original sequence version: 142 DIP protein P38398 original sequence version: 212 DIP protein P38398 original sequence version: 163 DIP protein P38398 original sequence version: 185 DIP protein P38398 original sequence version: 148 DIP protein P38398 original sequence version: 210 89C6D83FF56312AF bcl2-brca1 3 7 unspecified role unspecified role neutral component neutral component P10415:p.Gly145Ala mutation mutation certain certain sequence position certain certain certain sequence position certain G A Wed May 02 18:23:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly145ala' Tue Jun 30 19:27:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly145Ala' This mutation inhibits the apoptosis-inhibiting properties of Bcl2. 8 unspecified role unspecified role neutral component neutral component colocalization colocalization 4a, 4b bcl2-brca1-1 4 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 7c bcl2-brca1-2 2 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 7d bcl2-brca1-3 6 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 7d bcl2-brca1-4 1 8 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 7a bcl2-brca1-5 5 7 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 7c