IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis. Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis. J. Biol. Chem. (0021-9258) 2011 imex curation Czabotar P.E., Lee E.F., Thompson G.V., Wardak A.Z., Fairlie W.D., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis czabotar@wehi.edu.au 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Czabotar P.E., Lee E.F., Thompson G.V., Wardak A.Z., Fairlie W.D., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis czabotar@wehi.edu.au Accepted 2011-AUG-05 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 mgt Only protein-protein interactions imex curation Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis. Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis. J. Biol. Chem. (0021-9258) 2011 imex curation Czabotar P.E., Lee E.F., Thompson G.V., Wardak A.Z., Fairlie W.D., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis czabotar@wehi.edu.au 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Czabotar P.E., Lee E.F., Thompson G.V., Wardak A.Z., Fairlie W.D., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of BCL2L2 taken from previous work of the author. czabotar@wehi.edu.au Accepted 2011-AUG-05 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 mgt Only protein-protein interactions imex curation Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis. Mutation to Bax beyond the BH3 domain disrupts interactions with pro-survival proteins and promotes apoptosis. J. Biol. Chem. (0021-9258) 2011 imex curation Czabotar P.E., Lee E.F., Thompson G.V., Wardak A.Z., Fairlie W.D., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis czabotar@wehi.edu.au 23-Sept-2011: Contacted by JYOTI. mgt Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Czabotar P.E., Lee E.F., Thompson G.V., Wardak A.Z., Fairlie W.D., Colman P.M. Apoptosis - Interactions involving proteins with a function related to apoptosis czabotar@wehi.edu.au Accepted 2011-AUG-05 by ORCHARD 23-Sept-2011: Contacted by JYOTI. J. Biol. Chem. (0021-9258) 2011 mgt Only protein-protein interactions imex curation q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK DIP protein Q92843 original sequence version: 103 DIP protein Q92843 original sequence version: 85 DIP protein Q92843 original sequence version: 112 3542243A532B1762 mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F bax-mcl1-1 3 7 unspecified role unspecified role unspecified role unspecified role bh3 region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role unspecified role unspecified role purified purified region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1b working 0.21; free 0.25 2.5 A bax-bcl2l1-7 3 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component bh3 region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 17 19 direct interaction direct interaction Fig. 1c 2.60 A working 0.19; free 0.25 bcl2l11-bcl2l1-3 2 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 inhibitor inhibitor ancillary ancillary Q07812:p.Met74Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 17:31:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74glu' Tue Jun 30 17:38:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Glu' bh3 region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain Q07812:p.Met74Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A Wed May 02 14:55:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74ala' Tue Jun 30 17:47:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Ala' Q07812:p.Met74Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D Wed May 02 16:11:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74asp' Tue Jun 30 17:14:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Asp' chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Table 2 q07817-1 (bcl2l1) was most likely purified in E. coli, possibly with a His-tag. These statements are unclear due to the authors referring to previous papers (PMIDs 17572662 and 8692274) from which is impossible to infer whether the protein used there is the same the authors are using in the curated paper bcl2l11-mcl1 2 7 inhibitor inhibitor ancillary ancillary Q07812:p.Met74Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M K Wed May 02 19:53:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74lys' Tue Jun 30 15:43:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Lys' Q07812:p.Met74Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D Wed May 02 18:46:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74asp' Tue Jun 30 18:52:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Asp' bh3 region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain Q07812:p.Met74Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 15:25:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74glu' Tue Jun 30 19:03:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Glu' Q07812:p.Met74Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A Wed May 02 18:45:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74ala' Tue Jun 30 16:38:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Ala' Q07812:p.Met74Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M R Wed May 02 14:54:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74arg' Tue Jun 30 16:04:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Arg' chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray range range range range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Table 2 bcl2l11-bcl2-3 2 7 inhibitor inhibitor ancillary ancillary Q07812:p.Met74Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 18:32:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74glu' Tue Jun 30 19:09:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Glu' bh3 region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain Q07812:p.Met74Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M K Wed May 02 16:25:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74lys' Tue Jun 30 18:16:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Lys' Q07812:p.Met74Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D Wed May 02 20:18:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74asp' Tue Jun 30 16:56:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Asp' Q07812:p.Met74Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M A Wed May 02 19:42:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74ala' Tue Jun 30 19:16:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Ala' Q07812:p.Met74Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M R Wed May 02 14:34:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74arg' Tue Jun 30 17:42:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Arg' chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Table 2 bcl2l11-b2cl2 2 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind exp feature detect experimental feature detection exp feature detect certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 inhibitor inhibitor ancillary ancillary Q07812:p.Met74Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M K Wed May 02 16:50:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74lys' Tue Jun 30 18:32:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Lys' bh3 region sufficient to bind sufficient binding region sufficient to bind x-ray diffraction x-ray crystallography X-ray x-ray diffraction X-ray certain certain sequence position certain certain certain sequence position certain Q07812:p.Met74Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D Wed May 02 15:14:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74asp' Tue Jun 30 19:27:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Asp' Q07812:p.Met74Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 17:47:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74glu' Tue Jun 30 16:43:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Glu' chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Table 2 b2cl2 origin and features are not clear, as they have been inferred via author's references to previous works and there is information missing in reference with the precise sequence that was finally used for the construct. bax-bcl2l2 1 7 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q07812:p.Met74Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M R Wed May 02 15:29:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74arg' Tue Jun 30 17:30:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Arg' Q07812:p.Met74Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 20:23:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74glu' Tue Jun 30 16:16:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Glu' 8 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2 bax-bcl2-1 1 5 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait Q07812:p.Met74Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M R Wed May 02 15:50:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74arg' Tue Jun 30 16:02:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Arg' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q07812:p.Met74Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M K Wed May 02 18:26:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74lys' Tue Jun 30 19:17:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Lys' Q07812:p.Met74Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D Wed May 02 15:55:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74asp' Tue Jun 30 17:26:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Asp' Q07812:p.Met74Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 16:34:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74glu' Tue Jun 30 18:37:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Glu' physical association physical association Fig. 2 bax-bcl2l1-6 1 4 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait Q07812:p.Met74Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D Wed May 02 16:58:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74asp' Tue Jun 30 15:51:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Asp' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q07812:p.Met74Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M K Wed May 02 17:56:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74lys' Tue Jun 30 20:01:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Lys' Q07812:p.Met74Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 19:15:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74glu' Tue Jun 30 15:43:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Glu' physical association physical association Fig. 2 bax-mcl1 1 9 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait Q07812:p.Met74Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M E Wed May 02 16:43:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74glu' Tue Jun 30 20:02:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Glu' flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q07812:p.Met74Asp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M D Wed May 02 18:01:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74asp' Tue Jun 30 16:43:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Asp' Q07812:p.Met74Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain M K Wed May 02 18:30:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met74lys' Tue Jun 30 18:00:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met74Lys' physical association physical association Fig. 2