MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. EMBO J. (0261-4189) 2011 imex curation Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. EMBO J. (0261-4189) 2011 imex curation Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk Accepted 2011-SEP-26 by ORCHARD EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. EMBO J. (0261-4189) 2011 imex curation Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation Fis1 origin was confirmed by author, I've added a data origin comment to clarify it. About the vDED domain experiments, its deletion doesn't completely remove the interaction, that's why I chose to annotate for the rest of the protein as a "sufficient to bind" region. Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. Fis1 and Bap31 bridge the mitochondria-ER interface to establish a platform for apoptosis induction. EMBO J. (0261-4189) 2011 imex curation Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Iwasawa R., Mahul-Mellier A.L., Datler C., Pazarentzos E., Grimm S. Apoptosis - Interactions involving proteins with a function related to apoptosis Origin of proteins used for tagged constructs inferrred from author's email. s.grimm@imperial.ac.uk Accepted 2011-SEP-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2011 Only protein-protein interactions imex curation fis1_human Mitochondrial fission 1 protein FIS1 TTC11 FIS1 homolog Tetratricopeptide repeat protein 11 CGI-135 protein protein human Homo sapiens Human MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS 6E76EC02B3731A9B casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE D34367F870D6EB00 bcap31-fis1 2 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 2a fis1-bcap31 2 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 2a fis1-bcap31-1 3 5 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey p20bap31 fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2b bcap31-fis1-1 3 5 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait p20bap31 fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2b bcap31-fis1-2 1 5 unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization S2c fis1-bcap31-4 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 4a Casp8 binding depends on apoptosis induction using actinomycin D or etoposide. fis1-bcap31-3 3 7 unspecified role unspecified role prey prey bap31 del vded domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range certain certain sequence position certain certain certain sequence position certain range range Bap31 form lacking the variant of the DED domain (death effector domain) region. Mapping taken from PMID:15226512 flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4b bcap31-fis1-3 3 7 unspecified role unspecified role bait bait bap31 del vded domain sufficient to bind sufficient binding region sufficient to bind mutation analysis mutation analysis range range certain certain sequence position certain certain certain sequence position certain range range Bap31 form lacking the variant of the DED domain (death effector domain) region. Mapping taken from PMID:15226512 flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4b casp8-bcap31-1 4 7 unspecified role unspecified role prey prey vded domain required to bind necessary binding region required to bind mutation analysis mutation analysis range range range range Variant of the DED domain (death effector domain) region. Mapping taken from PMID:15226512 flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait physical association physical association 4c Casp8 binding depends on apoptosis induction using actinomycin D or etoposide. casp8-bcap31-3 2 5 unspecified role unspecified role ancillary ancillary fis1 knock down disrupts the interaction. 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 4d Casp8 binding depends on apoptosis induction using actinomycin D or etoposide.