IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Prevention of cytokine withdrawal-induced apoptosis by Mcl-1 requires interaction between Mcl-1 and Bim. Prevention of cytokine withdrawal-induced apoptosis by Mcl-1 requires interaction between Mcl-1 and Bim. Biochem. Cell Biol. (0829-8211) 2010 imex curation Jamil S., Wang S.W., Bondy L., Mojtabavi S., Duronio V. Apoptosis - Interactions involving proteins with a function related to apoptosis vduronio@interchange.ubc.ca 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions mouse-bmm mouse bone marrow derived macrophages bmm bone marrow derived macrophages Bone marrow derived macrophages (BMM) were generated in vitro from precursor cells harvested from the femurs of C57BL/6 mice (7�8 weeks) by proliferation and differentiation in the presence of L-cell conditioned medium. as a source of CSF-1 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jamil S., Wang S.W., Bondy L., Mojtabavi S., Duronio V. Apoptosis - Interactions involving proteins with a function related to apoptosis vduronio@interchange.ubc.ca Accepted 2011-OCT-26 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Biochem. Cell Biol. (0829-8211) 2010 Only protein-protein interactions imex curation Prevention of cytokine withdrawal-induced apoptosis by Mcl-1 requires interaction between Mcl-1 and Bim. Prevention of cytokine withdrawal-induced apoptosis by Mcl-1 requires interaction between Mcl-1 and Bim. Biochem. Cell Biol. (0829-8211) 2010 imex curation Jamil S., Wang S.W., Bondy L., Mojtabavi S., Duronio V. Apoptosis - Interactions involving proteins with a function related to apoptosis vduronio@interchange.ubc.ca 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions mouse-fdcp-1 Mus musculus bone marrow fdcp-1 long-term bone marrow culture of mice anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Jamil S., Wang S.W., Bondy L., Mojtabavi S., Duronio V. Apoptosis - Interactions involving proteins with a function related to apoptosis vduronio@interchange.ubc.ca Accepted 2011-OCT-26 by ORCHARD Biochem. Cell Biol. (0829-8211) 2010 Only protein-protein interactions imex curation mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F mcl1_mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Bcl-2-related protein EAT/mcl1 Mcl1 protein protein mouse Mus musculus Mouse MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein P97287 original sequence version: 123 E4FD369DB0EC6723 b2l11_mouse Bcl-2-like protein 11 Bcl2-interacting mediator of cell death Bcl2l11 Bim protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH DIP protein O54918 original sequence version: 130 531C176E5F1AC9AA mcl1-bcl2l11-1 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait Q07820:p.Thr163Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T E Wed May 02 14:33:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr163glu' Tue Jun 30 16:44:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr163Glu' This mutation mimics constitutive phosphorylation and increases mcl1 half-life, thus increasing the duration of the interaction over time. physical association physical association 3a Deprivation of growth factor IL3 (apoptosis-inducing conditions) increases the interaction. mcl1-bcl2l11-2 1 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 5b and 5c The interaction is monitored after growth factor M-CSF deprivation (induces apoptosis) and over time. In late stages of apoptosis (24-48 hours) there is a decrease in mcl1 levels and a concomitant decrease in the levels of bcl2l11 that is co-inmunoprecipitated with it.