InnateDB InnateDB IFI16 is an innate immune sensor for intracellular DNA. IFI16 is an innate immune sensor for intracellular DNA. Nat. Immunol. (1529-2908) 2010 imex curation Unterholzner L., Keating SE., Baran M., Horan KA., Jensen SB., Sharma S., Sirois CM., Jin T., Latz E., Xiao TS., Fitzgerald KA., Paludan SR., Bowie AG. Apoptosis - Interactions involving proteins with a function related to apoptosis agbowie@tcd.ie orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Unterholzner L., Keating SE., Baran M., Horan KA., Jensen SB., Sharma S., Sirois CM., Jin T., Latz E., Xiao TS., Fitzgerald KA., Paludan SR., Bowie AG. Apoptosis - Interactions involving proteins with a function related to apoptosis agbowie@tcd.ie Accepted 2011-APR-08 by ORCHARD Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity IFI16 is an innate immune sensor for intracellular DNA. IFI16 is an innate immune sensor for intracellular DNA. Nat. Immunol. (1529-2908) 2010 imex curation Unterholzner L., Keating SE., Baran M., Horan KA., Jensen SB., Sharma S., Sirois CM., Jin T., Latz E., Xiao TS., Fitzgerald KA., Paludan SR., Bowie AG. Apoptosis - Interactions involving proteins with a function related to apoptosis agbowie@tcd.ie orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-thp-1 Homo sapiens acute monocytic leukemia cells thp-1 Human acute monocytic leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Unterholzner L., Keating SE., Baran M., Horan KA., Jensen SB., Sharma S., Sirois CM., Jin T., Latz E., Xiao TS., Fitzgerald KA., Paludan SR., Bowie AG. Apoptosis - Interactions involving proteins with a function related to apoptosis agbowie@tcd.ie Accepted 2011-APR-08 by ORCHARD Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity if16_human Gamma-interferon-inducible protein 16 IFI16 IFNGIP1 Interferon-inducible myeloid differentiation transcriptional activator protein protein human Homo sapiens Human MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFEDIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPKGSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTTFPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTLKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF 216CD103D8F5206A sting_human Stimulator of interferon genes protein STING1 ERIS Endoplasmic reticulum interferon stimulator MITA Mediator of IRF3 activation TMEM173 Transmembrane protein 173 protein protein human Homo sapiens Human MPHSSLHPSIPCPRGHGAQKAALVLLSACLVTLWGLGEPPEHTLRYLVLHLASLQLGLLLNGVCSLAEELRHIHSRYRGSYWRTVRACLGCPLRRGALLLLSIYFYYSLPNAVGPPFTWMLALLGLSQALNILLGLKGLAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS DIP protein Q86WV6 original sequence version: 83 DIP protein Q86WV6 original sequence version: 47 DIP protein Q86WV6 original sequence version: 50 DIP protein Q86WV6 original sequence version: 100 DIP protein Q86WV6 original sequence version: 68 CB54D6A4D4D8E7C0 sting_mouse Stimulator of interferon genes protein Sting1 Endoplasmic reticulum interferon stimulator Eris Mediator of IRF3 activation Mita Mpys Tmem173 Transmembrane protein 173 protein protein mouse Mus musculus Mouse MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI tmem173-ifi16 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 4B THP-1 were pre-treated with PMA and IFN-a and transfected for 4hr with 1ug/mL of dsVACV 70mer (an IFN-beta-inducing vaccinia virus DNA motif) tmem173-ifi16-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4C THP-1 were pre-treated with PMA and IFN-a and transfected for 4hr with 1ug/mL of dsVACV 70mer (an IFN-beta-inducing vaccinia virus DNA motif) tm173-if16 1 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association Fig. 4C THP-1 were pre-treated with PMA and IFN-a and transfected for 4hr with 1ug/mL of dsVACV 70mer (an IFN-beta-inducing vaccinia virus DNA motif)