IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Cell (0092-8674) 2010 imex curation Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Accepted 2011-OCT-18 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2010 Only protein-protein interactions imex curation Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Cell (0092-8674) 2010 imex curation Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Accepted 2011-OCT-18 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2010 Only protein-protein interactions imex curation Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Cell (0092-8674) 2010 imex curation Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro polymerization polymerization western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Accepted 2011-OCT-18 by ORCHARD Cell (0092-8674) 2010 Only protein-protein interactions imex curation Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Cell (0092-8674) 2010 imex curation Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Accepted 2011-OCT-18 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2010 Only protein-protein interactions imex curation Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Cell (0092-8674) 2010 imex curation Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Accepted 2011-OCT-18 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2010 Only protein-protein interactions imex curation Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Membrane remodeling induced by the dynamin-related protein Drp1 stimulates Bax oligomerization. Cell (0092-8674) 2010 imex curation Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Montessuit S., Somasekharan S.P., Terrones O., Lucken-Ardjomande S., Herzig S., Schwarzenbacher R., Manstein D.J., Bossy-Wetzel E., Basanez G., Meda P., Martinou J.C. Apoptosis - Interactions involving proteins with a function related to apoptosis The assay was performed by checking Bax polymers resistance to trypsin digestion. The polymers were detected only by association with PC/PE/CL (phosphatidylcholine, phosphatidylethanolamine and cardiolipin) liposomes. jean-claude.martinou@unige.ch Accepted 2011-OCT-18 by ORCHARD 21-Dec-2011: Contacted by JYOTI. Cell (0092-8674) 2010 Only protein-protein interactions imex curation o00429-4 Dynamin-1-like protein HdynIV-37 DLP1b DNM1L DLP1 DRP1 Dnm1p/Vps1p-like protein Dynamin family member proline-rich carboxyl-terminal domain less Dynamin-like protein Dynamin-like protein 4 Dynamin-like protein IV Dynamin-related protein 1 protein protein human Homo sapiens Human MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDLLPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKISREVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQLDINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDCLPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEGTAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNATGPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYSTQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPDFADACGLMNNNIEEQRRNRLARELPSAVSRDKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVNHVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQIIAEIRETHLW CB252ECCC9871127 cardiolipin 1',3'-bis(1,2-diacyl-sn-glycero-3-phospho)-sn-glycerol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 bid_mouse BH3-interacting domain death agonist p22 BID Bid protein protein mouse Mus musculus Mouse MDSEVSNGSGLGAEHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD DIP protein P70444 original sequence version: 65 DIP protein P70444 original sequence version: 69 DIP protein P70444 original sequence version: 137 52F412714FB867F3 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 fis1_human Mitochondrial fission 1 protein FIS1 TTC11 FIS1 homolog Tetratricopeptide repeat protein 11 CGI-135 protein protein human Homo sapiens Human MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS 6E76EC02B3731A9B bax-bax-1 3 11 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 1d, 2a, 2e, 2f, 4g and 4h The presence of tBid and Drp1 as assistant proteins (fig. 1d) and cardiolipin as an integrant part of the liposomes (fig. 2a and 2b) was required for the oligomerization to happen. Drp1 mutants R247A and R247E (defficient in membrane fusion activity) could not promote oligonmerization of Bax (fig. 2e). Cytochrome C also increases Bax oligomerization (fig. 4f). The presence of LPC (lyso-phosphatidylcholine), which induces a positive curvature in lipid membranes, can disrupt Bax oligomerization in a dose-dependent manner. cardiolipin-bid 6 10 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) This form of bid is actually tBid, full length bid after processing via caspase 8 treatment (see PMID:10801880). 8 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2b cardiolipin-dnm1l-1 6 7 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2b dnm1l-dnm1l-1 5 7 unspecified role unspecified role prey prey O00429-4:p.Lys38Ala mutation mutation certain certain sequence position certain certain certain sequence position certain K A Wed May 02 14:49:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys38ala' Tue Jun 30 18:14:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys38Ala' GTPase deficient mutant ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O00429-4:p.Arg247Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:12:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg247ala' Tue Jun 30 19:32:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg247Ala' Membrane fusion activity-deficient mutant. 7 unspecified role unspecified role bait bait cfp tag cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4 cardiolipin-fis-1 6 12 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait purified purified chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction 2b dnm1l-gtp 4 7 enzyme enzyme unspecified role unspecified role purified purified n-terminal region of gtp-ase domain required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain This deletion disrupts the GTP-ase activity of dnm1l. O00429-4:p.[Thr59Ala;Pro159Ala;Lys216Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:36:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr59ala,pro159ala,lys216ala' Tue Jun 30 16:15:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr59Ala;Pro159Ala;Lys216Ala]' This set of mutations disrupts the GTP-ase activity of dnm1l. his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O00429-4:p.Lys38Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:46:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys38ala' Tue Jun 30 19:40:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys38Ala' This mutation disrupts the GTP-ase activity of dnm1l. ecoli Escherichia coli (strain K12) 9 enzyme target enzyme target substrate substrate unspecified role unspecified role gtpase reaction gtpase reaction 2d Key amino acids in the GTPase domain were mutated to produce GTPase-deficient mutants (Drp1 K38A, T59A/G149A/K216A) dnm1l-dnm1l-2 2 7 unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction 2h Protein is tetrameric in the presence of ATP, dimeric in its absence. bax-bax-2 1 11 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component physical association physical association S5 The presence of Drp1 increases Bax oligomerization.