I2D I2D A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability. A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability. Oncogene (0950-9232) 2011 imex curation Saether T., Pattabiraman DR., Alm-Kristiansen AH., Vogt-Kielland LT., Gonda TJ., Gabrielsen OS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Author confirms GST-SUMO1 construct is of human origin. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Saether T., Pattabiraman DR., Alm-Kristiansen AH., Vogt-Kielland LT., Gonda TJ., Gabrielsen OS. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms GST-SUMO1 construct is of human origin. Accepted 2011-JUN-10 by MGT Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability. A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability. Oncogene (0950-9232) 2011 imex curation Saether T., Pattabiraman DR., Alm-Kristiansen AH., Vogt-Kielland LT., Gonda TJ., Gabrielsen OS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Author confirms GST-SUMO1 construct is of human origin. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database in vitro In vitro pull down pull down autoradiography autoradiography Saether T., Pattabiraman DR., Alm-Kristiansen AH., Vogt-Kielland LT., Gonda TJ., Gabrielsen OS. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms GST-SUMO1 construct is of human origin. Accepted 2011-JUN-10 by MGT Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability. A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability. Oncogene (0950-9232) 2011 imex curation Saether T., Pattabiraman DR., Alm-Kristiansen AH., Vogt-Kielland LT., Gonda TJ., Gabrielsen OS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Author confirms GST-SUMO1 construct is of human origin. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Saether T., Pattabiraman DR., Alm-Kristiansen AH., Vogt-Kielland LT., Gonda TJ., Gabrielsen OS. Apoptosis - Interactions involving proteins with a function related to apoptosis Formaldehye was used for cross linking Author confirms GST-SUMO1 construct is of human origin. Accepted 2011-JUN-10 by MGT Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability. A functional SUMO-interacting motif in the transactivation domain of c-Myb regulates its myeloid transforming ability. Oncogene (0950-9232) 2011 imex curation Saether T., Pattabiraman DR., Alm-Kristiansen AH., Vogt-Kielland LT., Gonda TJ., Gabrielsen OS. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer Author confirms GST-SUMO1 construct is of human origin. mgt Only protein-protein interactions Curated by: I2D - Interologous Interaction Database chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast confocal microscopy confocal microscopy immunostaining immunostaining Saether T., Pattabiraman DR., Alm-Kristiansen AH., Vogt-Kielland LT., Gonda TJ., Gabrielsen OS. Apoptosis - Interactions involving proteins with a function related to apoptosis Author confirms GST-SUMO1 construct is of human origin. Accepted 2011-JUN-10 by MGT Oncogene (0950-9232) 2011 mgt Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database sumo2_human Small ubiquitin-related modifier 2 SMT3 homolog 2 Sentrin-2 HSMT3 SUMO-3 SUMO2 SMT3H2 SMT3B Ubiquitin-like protein SMT3B protein protein human Homo sapiens Human MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY DIP protein P61956 original sequence version: 39 DIP protein P61956 original sequence version: 79 DIP protein P61956 original sequence version: 81 DIP protein P61956 original sequence version: 77 DIP protein P61956 original sequence version: 98 DIP protein P61956 original sequence version: 116 DIP protein P61956 original sequence version: 141 F8F0426849BEF08B sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 pml_human Protein PML PML MYL RNF71 TRIM19 Tripartite motif-containing protein 19 RING finger protein 71 Promyelocytic leukemia protein PP8675 E3 SUMO-protein ligase PML RING-type E3 SUMO transferase PML protein protein human Homo sapiens Human MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEELDAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEAVDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLRQEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPEEAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENLADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQHFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPGASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFASLQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS DIP protein P29590 original sequence version: 188 DIP protein P29590 original sequence version: 195 DIP protein P29590-1 original sequence version: 187 D50968A977E34287 myc_human_gene Human c-myc gene gene gene human Homo sapiens Human myb_avimb Transforming protein Myb V-MYB protein protein avimb Avian myeloblastosis virus NRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKVEQEGYPQESSKAGPPSATTGFQKSSHLMAFAHNPPAGPLPGAGQAPLGSDYPYYHIAEPQNVPGQIPYPVALHINIINVPQPAAAAIQRHYTDEDPEKEKRIKELELLLMSTENELKGQQALPTQNHTANYPGWHSTTVADNTRTSGDNAPVSCLGEHHHCTPSPPVDHGCLPEESASPARCMIVHQSNILDNVKNLLEFAETLQLIDSFLNTSSNHENLNLDNPALTSTPVCGHKMSVTTPFHKDQTFTEYRKMHGGAV 1459BACAD29EC971 myb_human Transcriptional activator Myb MYB Proto-oncogene c-Myb protein protein human Homo sapiens Human MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTVNNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELELLLMSTENELKGQQVLPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSDLEMPSLTSTPLIGHKLTVTTPFHRDQTVKTQKENTVFRTPAIKRSILESSPRTPTPFKHALAAQEIKYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGNFFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM DIP protein P10242 original sequence version: 144 DIP protein P10242 original sequence version: 133 DIP protein P10242 original sequence version: 157 FD5E6694020426ED myb-sumo1 1 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P10242:p.[Val267Ala;Ile269Ala;Val270Ala] val267ala-ile269ala-val270ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain V A Fri Jul 22 10:51:40 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val270ala,ile269ala,val267ala' Wed May 02 18:57:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val267ala,ile269ala,val270ala' Tue Jun 30 19:53:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val267Ala;Ile269Ala;Val270Ala]' chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 3a, b, c, d, S2 myb-sumo2 1 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P10242:p.[Val267Ala;Ile269Ala;Val270Ala] val267ala-ile269ala-val270ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain V A Fri Jul 22 10:49:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val270ala,ile269ala,val267ala' Wed May 02 16:43:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val267ala,ile269ala,val270ala' Tue Jun 30 19:58:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val267Ala;Ile269Ala;Val270Ala]' chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association Fig. 3a, b, c, d, S2 v-myb-sumo1 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association Fig. S2 v-myb-sumo2 1 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association Fig. S2 myb-sumo1-1 1 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. S1 myb-sumo2-1 1 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. S1 myb-pml 4 7 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. S5 myb-sumo1-2 2 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P10242:p.[Val267Ala;Ile269Ala;Val270Ala] val267ala-ile269ala-val270ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain V A Fri Jul 22 11:05:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val270ala,ile269ala,val267ala' Wed May 02 19:35:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val267ala,ile269ala,val270ala' Tue Jun 30 19:46:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val267Ala;Ile269Ala;Val270Ala]' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P10242:p.[Val267Ile;Val270Ile] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain V I certain certain sequence position certain certain certain sequence position certain V I Wed May 02 18:51:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val267ile,val270ile' Tue Jun 30 18:25:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val267Ile;Val270Ile]' in vitro In vitro direct interaction direct interaction Fig. S3 myb-sumo2-3 2 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P10242:p.[Val267Ala;Ile269Ala;Val270Ala] val267ala-ile269ala-val270ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain V A Fri Jul 22 11:02:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'val270ala,ile269ala,val267ala' Wed May 02 17:57:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val267ala,ile269ala,val270ala' Tue Jun 30 19:08:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val267Ala;Ile269Ala;Val270Ala]' region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P10242:p.[Val267Ile;Val270Ile] mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain V I certain certain sequence position certain certain certain sequence position certain V I Wed May 02 14:53:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val267ile,val270ile' Tue Jun 30 19:40:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val267Ile;Val270Ile]' in vitro In vitro direct interaction direct interaction Fig. S3 myb-myc 3 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey association association S4a c-Myb occupies the MYC promoter.