InnateDB InnateDB The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip anti tag western anti tag western blot anti tag western He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis GST-TACI was IP out, author did not specify whether the IP Ab recognize GST or TACI. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis GST-TACI was IP out, author did not specify whether the IP Ab recognize GST or TACI. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-b-cell Mus musculus B-cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis primary naive B cells were cultured for with 0, 5, 15mins APRIL before performing the endogenous CoIP. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] pull down pull down western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity mouse-b-cell Mus musculus B-cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] confocal microscopy confocal microscopy immunostaining immunostaining He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity in vitro In vitro pull down pull down autoradiography autoradiography He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] confocal microscopy confocal microscopy immunostaining immunostaining He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis primary naive B cells were cultured for 15min with medium (ctrl) or APRIL before performing the confocal microscopy. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. The transmembrane activator TACI triggers immunoglobulin class switching by activating B cells through the adaptor MyD88. Nat. Immunol. (1529-2908) 2010 imex curation He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es 06-Jun-2011: Contacted by JYOTI. orchard Only protein-protein interactions Curated by: InnateDB - a knowledge resource for innate immunity human-b-cell Homo sapiens B cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot He B., Santamaria R., Xu W., Cols M., Chen K., Puga I., Shan M., Xiong H., Bussel JB., Chiu A., Puel A., Reichenbach J., Marodi L., Doffinger R., Vasconcelos J., Issekutz A., Krause J., Davies G., Li X., Grimbacher B., Plebani A., Meffre E., Picard C., Cunningham-Rundles C., Casanova JL., Cerutti A. Apoptosis - Interactions involving proteins with a function related to apoptosis experiment used 2E2 cell line, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. Experiment used 2E2, which is a subclone cell line of an IgD+ CL-01 human B cell line that undergoes MyD88-dependent class switching in response to TLR signals. acerutti@imim.es Accepted 2011-APR-27 by ORCHARD 06-Jun-2011: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2010 orchard Only protein-protein interactions imex curation Curated by: InnateDB - a knowledge resource for innate immunity traf5_human TNF receptor-associated factor 5 RING finger protein 84 TRAF5 RNF84 protein protein human Homo sapiens Human MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL 86EB3724CE111176 myd88_human Myeloid differentiation primary response protein MyD88 MYD88 protein protein human Homo sapiens Human MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP CEAE3F6B99524333 traf6_mouse TNF receptor-associated factor 6 RING-type E3 ubiquitin transferase TRAF6 Traf6 E3 ubiquitin-protein ligase TRAF6 protein protein mouse Mus musculus Mouse MSLLNCENSCGSSQSSSDCCAAMAASCSAAVKDDSVSGSASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEVSTRFDMGGLRKEGFQPRSTDAGV DIP protein P70196 original sequence version: 139 DIP protein P70196 original sequence version: 128 DIP protein P70196 original sequence version: 144 DIP protein P70196 original sequence version: 83 DIP protein P70196 original sequence version: 98 DIP protein P70196 original sequence version: 104 DIP protein P70196 original sequence version: 112 DIP protein P70196 original sequence version: 163 F8389250425E4E2D traf5_mouse TNF receptor-associated factor 5 Traf5 protein protein mouse Mus musculus Mouse MAHSEEQAAVPCAFIRQNSGNSISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDLTDLEDL DIP protein P70191 original sequence version: 132 48F64FB83BD587E5 traf2_mouse TNF receptor-associated factor 2 Traf2 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein mouse Mus musculus Mouse MAAASVTSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein P39429 original sequence version: 90 DIP protein P39429 original sequence version: 130 DIP protein P39429 original sequence version: 135 DIP protein P39429 original sequence version: 166 043B391180365F10 camlg_mouse Guided entry of tail-anchored proteins factor CAMLG Camlg Caml Calcium signal-modulating cyclophilin ligand Get2 protein protein mouse Mus musculus Mouse MEPVPAATDGGERPATPSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGSEEENQTKSKPQDSDKLNSLSIPSVSKRVVLGDSVDGGGADQLGGVAEVRGTQLGDKLDSFIKAPECSSKDGAELRQRTRGDLTADPAQRASHHGLEQYLSRFEEAMKLRKQLISEKPSQEDGSTAEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKGEKKVKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGPEVP D21AC54BC9F609E5 traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV DIP protein Q9Y4K3 original sequence version: 154 DIP protein Q9Y4K3 original sequence version: 91 DIP protein Q9Y4K3 original sequence version: 114 DIP protein Q9Y4K3 original sequence version: 118 DIP protein Q9Y4K3 original sequence version: 140 DIP protein Q9Y4K3 original sequence version: 159 DIP protein Q9Y4K3 original sequence version: 132 DIP protein Q9Y4K3 original sequence version: 158 DIP protein Q9Y4K3 original sequence version: 171 DIP protein Q9Y4K3 original sequence version: 117 DIP protein Q9Y4K3 original sequence version: 113 5AB9C255CCFEE749 traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 irak1_human Interleukin-1 receptor-associated kinase 1 IRAK1 IRAK protein protein human Homo sapiens Human MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRLHCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFGLARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAGQRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDPRPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPPSPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALRSWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQIIINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS DIP protein P51617 original sequence version: 141 DIP protein P51617 original sequence version: 84 DIP protein P51617 original sequence version: 85 DIP protein P51617-1 original sequence version: 103 DIP protein P51617-1 original sequence version: 108 DIP protein P51617 original sequence version: 113 DIP protein P51617 original sequence version: 123 A7ADED75D3A3981D camlg_human Guided entry of tail-anchored proteins factor CAMLG CAMLG CAML Calcium signal-modulating cyclophilin ligand GET2 protein protein human Homo sapiens Human MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP 22DCD8CF022FEF09 tnr5_human Tumor necrosis factor receptor superfamily member 5 CD40L receptor B-cell surface antigen CD40 Bp50 CDw40 CD40 TNFRSF5 protein protein human Homo sapiens Human MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ DIP protein P25942 original sequence version: 156 BC8776EC2C4A5680 irak4_mouse Interleukin-1 receptor-associated kinase 4 Irak4 protein protein mouse Mus musculus Mouse MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPATLLLPDAVPQTVKSLPPREAATVAQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTRFHSFSFHELKSITNNFDEQPASAGGNRMGEGGFGVVYKGCVNNTIVAVKKLGAMVEISTEELKQQFDQEIKVMATCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCLDGTPPLSWHTRCKVAQGTANGIRFLHENHHIHRDIKSANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLELITGLAAVDENREPQLLLDIKEEIEDEEKTIEDYTDEKMSDADPASVEAMYSAASQCLHEKKNRRPDIAKVQQLLQEMSA DIP protein Q8R4K2 original sequence version: 107 DIP protein Q8R4K2 original sequence version: 98 DIP protein Q8R4K2 original sequence version: 77 FC11AD06983B7AEB myd88_mouse Myeloid differentiation primary response protein MyD88 Myd88 protein protein mouse Mus musculus Mouse MSAGDPRVGSGSLDSFMFSIPLVALNVGVRRRLSLFLNPRTPVAADWTLLAEEMGFEYLEIRELETRPDPTRSLLDAWQGRSGASVGRLLELLALLDREDILKELKSRIEEDCQKYLGKQQNQESEKPLQVARVESSVPQTKELGGITTLDDPLGQTPELFDAFICYCPNDIEFVQEMIRQLEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGVQQKRLIPIKYKAMKKDFPSILRFITICDYTNPCTKSWFWTRLAKALSLP DIP protein P22366 original sequence version: 131 DIP protein P22366 original sequence version: 141 DIP protein P22366-1 original sequence version: 143 DIP protein P22366-1 original sequence version: 144 DIP protein P22366 original sequence version: 122 393A75C3723FFE69 tnr17_human Tumor necrosis factor receptor superfamily member 17 B-cell maturation protein TNFRSF17 BCM BCMA protein protein human Homo sapiens Human MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKSISAR B6D87B3685F66022 tr13b_human Tumor necrosis factor receptor superfamily member 13B Transmembrane activator and CAML interactor TNFRSF13B TACI protein protein human Homo sapiens Human MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYSTLGLCLCAVLCCFLVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA 411799F3DE17A5EB tr13b_mouse Tumor necrosis factor receptor superfamily member 13B Tnfrsf13b Taci Transmembrane activator and CAML interactor protein protein mouse Mus musculus Mouse MAMAFCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCTLGVCLCAIFCCFLVALASFLRRRGEPLPSQPAGPRGSQANSPHAHRPVTEACDEVTASPQPVETCSFCFPERSSPTQESAPRSLGIHGFAGTAAPQPCMRATVGGLGVLRASTGDARPAT CB2F2D61C2931D81 irak4_human Interleukin-1 receptor-associated kinase 4 Renal carcinoma antigen NY-REN-64 IRAK4 protein protein human Homo sapiens Human MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS DIP protein Q9NWZ3 original sequence version: 93 DIP protein Q9NWZ3 original sequence version: 92 DIP protein Q9NWZ3 original sequence version: 144 6C8156ADF25FF81E camlg-myd88 4 12 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey association association Fig. 2A, 4B, 4E deletion and mutation for Myd88 interaction: region required to bind=226-239; TACI mutation-decreasing= Glu228Arg, Thr229Arg, Ser231Arg, Cys233Gly tnfrsf17-traf5 4 12 unspecified role unspecified role prey prey 25 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role prey prey association association Fig. 2A cd40-myd88 4 22 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey association association Fig. 2A tnfrsf13b-irak1 4 20 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey association association Fig. 5E (left) tnfrsf13b-irak4 4 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 28 unspecified role unspecified role prey prey physical association physical association Fig. 5E (right) tnfrsf13b-myd88 6 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2B tnfrsf13b-myd88-1 6 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5B tnfrsf13b-myd88-2 11 26 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association Fig. 2C (lane 2) camlg-traf5 11 12 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey association association Fig. S9B. myd88-tnfrsf13b 9 13 unspecified role unspecified role bait bait 26 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2C (lane 4) tnfrsf13b-myd88-3 7 13 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Fig. 2D tnfrsf13b-myd88-4 8 26 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey association association Fig. 2E APRIL treatment for 15mins doubled the amount of myd88 IP out camlg-irak4 3 23 unspecified role unspecified role prey prey 27 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey association association Fig. 3A APRIL 5-15mins traf2-myd88-1 10 19 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 26 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 2F polarized membrane patches of colocalized proteins were only present when B cells are stimulated with APRIL myd88-tr13b 5 27 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component 24 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 3B polarized membrane patches of colocalized proteins were only present when B cells are stimulated with APRIL tnfrsf13b-myd88-5 1 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. S4 camlg-myd88-3 2 21 unspecified role unspecified role prey prey 26 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 19 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey association association Fig. S10B. ser194xaa mutation in TACI decreased the interaction with Myd88 only. traf6-myd88-1 10 26 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. S5A, polarized membrane patches of colocalized proteins were only present when B cells are stimulated with APRIL camlg-myd88-1 10 13 unspecified role unspecified role neutral component neutral component 26 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp. Fig. 5B polarized membrane patches of colocalized proteins were only present when B cells are stimulated with APRIL