UniProt UniProt http://www.uniprot.org SIRT1 regulates UV-induced DNA repair through deacetylating XPA. SIRT1 regulates UV-induced DNA repair through deacetylating XPA. Mol. Cell (1097-2765) 2010 imex curation Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Accepted 2011-DEC-02 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation SIRT1 regulates UV-induced DNA repair through deacetylating XPA. SIRT1 regulates UV-induced DNA repair through deacetylating XPA. Mol. Cell (1097-2765) 2010 imex curation Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Accepted 2011-DEC-02 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation SIRT1 regulates UV-induced DNA repair through deacetylating XPA. SIRT1 regulates UV-induced DNA repair through deacetylating XPA. Mol. Cell (1097-2765) 2010 imex curation Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Accepted 2011-DEC-02 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation SIRT1 regulates UV-induced DNA repair through deacetylating XPA. SIRT1 regulates UV-induced DNA repair through deacetylating XPA. Mol. Cell (1097-2765) 2010 imex curation Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Accepted 2011-DEC-02 by ORCHARD Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation SIRT1 regulates UV-induced DNA repair through deacetylating XPA. SIRT1 regulates UV-induced DNA repair through deacetylating XPA. Mol. Cell (1097-2765) 2010 imex curation Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro deacetylase assay deacetylase assay autoradiography autoradiography Fan W., Luo J. Apoptosis - Interactions involving proteins with a function related to apoptosis XPA plasmids and purified protein from Zou J., who worked with human proteins, see pmid 12390028. SIRT1 plasmids according pmid 11672522. In vitro acetylation assay using p300 omitted its species origin can not be established from the publication. CoIP exp fig7A omitted as host cannot be established from the publication. jluo@som.umaryland.edu Accepted 2011-DEC-02 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F rfa2_human Replication protein A 32 kDa subunit RPA34 Replication protein A 34 kDa subunit Replication factor A protein 2 RPA2 REPA2 RPA32 protein protein human Homo sapiens Human MWNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPLEDMNEFTTHILEVINAHMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE DIP protein P15927 original sequence version: 119 DIP protein P15927-1 original sequence version: 125 DIP protein P15927 original sequence version: 114 61A563EA7B34A9B1 xpa_human DNA repair protein complementing XP-A cells XPA XPAC Xeroderma pigmentosum group A-complementing protein protein protein human Homo sapiens Human MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM DIP protein P23025 original sequence version: 75 DIP protein P23025 original sequence version: 116 F89F735219A8494B sirt1-xpa 4 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2B xpa-sirt1 3 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2C and S4 sirt1-xpa-2 3 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 2C and S4 sirt1-xpa-3 5 8 enzyme target enzyme target substrate substrate neutral component neutral component region ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 enzyme enzyme neutral component neutral component deacetylation deacetylation reaction deacetylation 4B xpa-rpa2 3 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 7C xpa-rpa2-1 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association S7 sirt1-xpa-4 1 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association S3A xpa-sirt1-1 1 8 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association S3B xpa-sirt1-2 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association S4 sirt1-xpa-5 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association S4