UniProt UniProt http://www.uniprot.org Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Nucleic Acids Res. (0305-1048) 2010 mimix curation Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr 14-Mar-2012: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr Accepted 2011-DEC-08 by JYOTI 14-Mar-2012: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 mimix curation Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Nucleic Acids Res. (0305-1048) 2010 mimix curation Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr 14-Mar-2012: Contacted by JYOTI. mouse-p19 Mus musculus embryonic teratocarcinoma cell line, epithelial-like, induced by retinoic acid p19 mouse embryonic teratocarcinoma cellline anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr Accepted 2011-DEC-08 by JYOTI 14-Mar-2012: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 mimix curation Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Nucleic Acids Res. (0305-1048) 2010 mimix curation Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr 14-Mar-2012: Contacted by JYOTI. human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr Accepted 2011-DEC-08 by JYOTI 14-Mar-2012: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 mimix curation Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Nucleic Acids Res. (0305-1048) 2010 mimix curation Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr 14-Mar-2012: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr Accepted 2011-DEC-08 by JYOTI Nucleic Acids Res. (0305-1048) 2010 mimix curation Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Nucleic Acids Res. (0305-1048) 2010 mimix curation Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr 14-Mar-2012: Contacted by JYOTI. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr Accepted 2011-DEC-08 by JYOTI 14-Mar-2012: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 mimix curation Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Nucleic Acids Res. (0305-1048) 2010 mimix curation Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr 14-Mar-2012: Contacted by JYOTI. human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr Accepted 2011-DEC-08 by JYOTI 14-Mar-2012: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 mimix curation Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Nucleic Acids Res. (0305-1048) 2010 mimix curation Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr 14-Mar-2012: Contacted by JYOTI. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr Accepted 2011-DEC-08 by JYOTI 14-Mar-2012: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 mimix curation Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Reciprocal roles of SIRT1 and SKIP in the regulation of RAR activity: implication in the retinoic acid-induced neuronal differentiation of P19 cells. Nucleic Acids Res. (0305-1048) 2010 mimix curation Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr 14-Mar-2012: Contacted by JYOTI. human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. fluorescence imaging fluorescence microscopy fluorescence imaging anti tag immunost anti tag immunostaining anti tag immunost Kang M.R., Lee S.W., Um E., Kang H.T., Hwang E.S., Kim E.J., Um S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis nbrejk@dankook.ac.kr Accepted 2011-DEC-08 by JYOTI 14-Mar-2012: Contacted by JYOTI. Nucleic Acids Res. (0305-1048) 2010 mimix curation rara_human Retinoic acid receptor alpha RARA NR1B1 Nuclear receptor subfamily 1 group B member 1 protein protein human Homo sapiens Human MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP DIP protein P10276 original sequence version: 190 DIP protein P10276 original sequence version: 118 DIP protein P10276 original sequence version: 162 DIP protein P10276-1 original sequence version: 143 DIP protein P10276 original sequence version: 200 DIP protein P10276-1 original sequence version: 152 E8D1CF9A1E57CB99 snw1_human SNW domain-containing protein 1 Nuclear protein SkiP Ski-interacting protein Nuclear receptor coactivator NCoA-62 SKIIP SKIP SNW1 protein protein human Homo sapiens Human MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE DIP protein Q13573 original sequence version: 156 0CC75E0D0B2CF842 rara_mouse Retinoic acid receptor alpha Rara Nr1b1 Nuclear receptor subfamily 1 group B member 1 protein protein mouse Mus musculus Mouse MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP DIP protein P11416 original sequence version: 140 726F7799633A85AD sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F snw1_mouse SNW domain-containing protein 1 Skiip Nuclear protein SkiP Ski-interacting protein Snw1 protein protein mouse Mus musculus Mouse MALTSFLPAPTQLSQDQLEAEERARSQRSLQTSLVSSRREPPPYGYRKGWIPRLLEDFGDGGAFPEIHVAQYPLDMGRKKKMSNALAIQVDPEGKIKYDAIARQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYTPSQQGVAFNSGAKQRVIRMVEMQKEPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVKEQQEWKIPPCISNWKNAKGYTIPIDKRLAADGRGLQTVHINENFAKLAEALYIADRKAREAVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRRKERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSGSDRKQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE DIP protein Q9CSN1 original sequence version: 93 1B5D050105BC6AAC esr1_human Estrogen receptor ESR1 ESR NR3A1 Estradiol receptor ER-alpha Nuclear receptor subfamily 3 group A member 1 protein protein human Homo sapiens Human MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV DIP protein P03372 original sequence version: 214 DIP protein P03372 original sequence version: 139 DIP protein P03372 original sequence version: 167 5455C57AB0CCCAA7 sir1_mouse NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 Sirt1 Sir2l1 SIR2alpha SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein mouse Mus musculus Mouse MADEVALALQAAGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALWREAAGAAASAEREAPATAVAGDGDNGSGLRREPRAADDFDDDEGEEEDEAAAAAAAAAIGYRDNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRPQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQATNNNVNDLEVSESSCVEEKPQEVQTSRNVENINVENPDFKAVGSSTADKNERTSVAETVRKCWPNRLAKEQISKRLEGNQYLFVPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDTERPECAGGSGFGADGGDQEVVNEAIATRQELTDVNYPSDKS DIP protein Q923E4 original sequence version: 83 DIP protein Q923E4 original sequence version: 135 7F15625E29433119 sirt1-snw1 4 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association no figure sirt1-snw1-1 1 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 1B, C and D snw1-sirt1 7 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait direct interaction direct interaction 2A snw1-sirt1-1 6 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 2B sirt1-snw1-2 6 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 2B sirt1-snw1-3 8 10 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 2C rara-sirt1 8 10 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 3C rara-snw1 1 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 3A and B esr1-snw1 1 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 3A rara-sirt1-1 3 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait association association 4A and C retinoic acid sirt1-rara 5 9 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait direct interaction direct interaction 4B retinoic acid sirt1-rara-1 7 12 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 4D Increasing amounts of SNW1/SKIP decrease the association with RAR alpha/RARA sirt1-snw1-4 2 15 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 6A rara-sirt1-2 2 11 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association 6B retinoic acid