IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. Cell (0092-8674) 2009 imex curation Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 4 imex curation GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. Cell (0092-8674) 2009 imex curation Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 4 in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay autoradiography autoradiography Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 4 imex curation GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. Cell (0092-8674) 2009 imex curation Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 4 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 4 imex curation GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. Cell (0092-8674) 2009 imex curation Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 4 imex curation GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. Cell (0092-8674) 2009 imex curation Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 4 in vitro In vitro liposome binding assay liposome binding assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis Small unilamellar lipid vesicles of 55 nmol PE or 55 nmol PE plus 2.5 nmol PtdIns(3)P or PtdIns(4)P were prepared by sonication, vesicle-bound proteins isolated by centrifugation. sjfield@ucsd.edu Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 4 imex curation GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. GOLPH3 Bridges Phosphatidylinositol-4- Phosphate and Actomyosin to Stretch and Shape the Golgi to Promote Budding. Cell (0092-8674) 2009 imex curation Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu 23-Feb-2010: Contacted by JYOTI. jyoti Only protein-protein interactions 4 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dippold HC., Ng MM., Farber-Katz SE., Lee SK., Kerr ML., Peterman MC., Sim R., Wiharto PA., Galbraith KA., Madhavarapu S., Fuchs GJ., Meerloo T., Farquhar MG., Zhou H., Field SJ. Apoptosis - Interactions involving proteins with a function related to apoptosis sjfield@ucsd.edu Accepted 2010-FEB-12 by JYOTI. 23-Feb-2010: Contacted by JYOTI. Cell (0092-8674) 2009 jyoti Only protein-protein interactions 4 imex curation akt1_drome RAC serine/threonine-protein kinase Akt1 CG4006 Akt Protein kinase B protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNYLPFVLQRRSTVVASAPAPGSASRIPESPTTTGSNIINIIYSQSTHPNSSPTSGSAEKFSWQQSWPSRTSAAPTHDSGTMSINTTFDLSSPSVTSGHALTEQTQVVKEGWLMKRGEHIKNWRQRYFVLHSDGRLMGYRSKPADSASTPSDFLLNNFTVRGCQIMTVDRPKPFTFIIRGLQWTTVIERTFAVESELERQQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKKVTLENFEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVLKSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPDPTGPLGSIAEEPLFPQFSYQGDMASTLGTSSHISTSTSLASMQ DIP protein Q8INB9 original sequence version: 105 C139380152580934 pi3p 1-phosphatidyl-1D-myo-inositol 3-phosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pi4p 1-phosphatidyl-1D-myo-inositol 4-phosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) vps74_yeast Vacuolar protein sorting-associated protein 74 VPS74 D9481.15 YDR372C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 9D111E5F894F3646 9D111E5F894F3646 golp3_human Golgi phosphoprotein 3 GOLPH3 GPP34 Coat protein GPP34 Mitochondrial DNA absence factor protein protein human Homo sapiens Human MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK 34FAD78155CC214A 1-phosphatidyl-1d-myo-inositol 3,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9vbd0_drome Tb Dmel\CG5480 Tu TwdlA Dmel_CG5480 CG5480 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MRGFIIFAVLAVARADVGGYNYGAGIGSGGSISGGSLSGGSISGGSISGGSISGGSISGGSISGGSLSSGSLSGGSYSTNYAPVNTEFNKEFFTYSAPEADFEDNKSVSDLAATLKKNLRVVFIRAPENKGLENAALALAKQAAEQQTAIYVLTKQGDLSSLANQLQNLNHVSASKPEVHFVKYRTQQDAINAQRTIQQEYERLGGASTSYNGGVAPVLDFATKVQQQQEQQQQQQQQQVQLIDERRPSSGSVSAELEAPSAGYIPPPAAAPSATYLPVNKVK B113DCFDAE308E15 q7k9h6_drome Zinc finger FYVE domain-containing protein Sara Sara-RA Dmel\CG15667 SARA dSARA sara CG15667 Dmel_CG15667 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDLVDIDQVLDNLELSIAADEQLSRNAAAAAAAGANPGRFLGDGASASISGVGAGAGVSGAAGVTPTPASGKSFVGVSQVFNSLDDYRENVKSLQVDAQLPSYDWQTEAEHEDDIHKFSEQASKNNGQTIVSSSESLTTSSCSTFSSGPSPVSNGSHSEELATPPEDEKTSEVQVEPKEQDQQPEQVKHEDQHQDQAVPPPTQSKQTVEELAVGLSSISITASGTESQSLLPEEVTASSVLGQVLEELSEESSPSREPETEMTNGIDVPLANLPASVAEVPVPKEMEQPVQTEEEDVELPQEQHPRRSQPLTFCSTMDEISDTELDSMLQEMDADDNQADDQQMPDDEKSCSASPVTEEESVRILSDEQETTSNDQMNVDNFSQASTVEFADLKQPESTPVTAMGEDVASSFSSTESDSLSGRKLDGEVEVDREHEDASLATDALETQEQRPQRPQTLNLNGCQAESSTPSQDENPEIQQETLQPTEVREGAAGVGVIPGEDDEESPIYEAVGYSDPHANLGKVPPIWVPDNMAGQCMQCQQKFTMIKRRHHCRACGKVLCSVCCSQRFRLEFATEPESRVCVQCYMILSERQANGLNSESAPGSALPPTPIRSPNPNNPMEYCSTIPPHRQVANSPGAPPPSVIVPVGVLKKTDGSSSNSSSSDGQKGQRKRKSVMFSDGIAPGSELASTMEQQWGESKHSRRGLSRSGSGAGQKPPTPATEEPPRSIDTSSTLGLVAQLFRGSIPPSAAAATLSATETSAGRSSSQSQAQTSPRRKAESSRNRKLPPNGDAQGCYLPPEENGLPPICISSKEGGEVDYKVVRNDGSLLDRLQNETLKFIIKNNFFVLVKIVNMSCCMNRWVLNFTTSGLHHMGSDELIILLEIKQPKQEEYVKGEVAIPKDLFQHLYEIYVEAEHARSGTHELAFTSPRNANFLGSREHGGFIFIRPTYQCLQGVIVPDNPYLVGVLIHRHEVPWAKVLPLRLILRLGAQYRYYPCPLISVRGRESVYGEIAQTIINFLVDFRNYSYSLPAIRGLYIHMEDRQTTVIIPKYRQQDVIKAINNASDHILAFAGNFSKVADGHLVCMQNINDDRSEMYSYSTQAINIQGQPRKITGASFFVLNEALKSSSGLSGKCSIVEDGLMVQIMPAKMEEVRQALRNQNDIDIVCGPIDATDDQSEIVSIKWVDNNRDINVGVKSPIDDQPMDGISNMRVLKWASFNYSNTNYAIRLSDIYIIKCEDWYATNGGNCEEITRIAEQLARSASMALLPLLDLLAAAGINKLGLRATLDQDNVGYEAGARGSKLPPLYMNALDNHLIATLHGESSGIQEPIILELIFYILNA F0C1B82A045EBD7B golp3_drome Golgi phosphoprotein 3 homolog sauron sau GOLPH3 Protein rotini l(2)s5379 rti CG7085 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNRSDGLVRRSVKPRENGGAEGGLNANTPDDNQDALDNLKDQEDNIDDGDSKETRLTLMEEVLLLGLKDKEGYTSFWNDCISSGLRGCILIELGLRGRVMIEKSGMRRRGLCTRKLILKSDQQTGDVLLDEALKHIKETDPPETVQSWIEYLSGETWNPLKLRYQLKNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLSDNVVKCRLVKKIQDSVLSKWVNDPQRMDKRMLALIFLAHASDVIENAFAPLNDDDYEVAMKRVRELLDLDFEAESAKPNANEILWAVFMAFTK 7F3C52EE18597B5E phosphatidic acids phosphatidic acids small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) my18a_human Unconventional myosin-XVIIIa Myosin containing a PDZ domain Molecule associated with JAK3 N-terminus MYO18A KIAA0216 MYSPDZ CD245 Surfactant protein receptor SP-R210 protein protein human Homo sapiens Human MFNLMKKDKDKDGGRKEKKEKKEKKERMSAAELRSLEEMSLRRGFFNLNRSSKRESKTRLEISNPIPIKVASGSDLHLTDIDSDSNRGSVILDSGHLSTASSSDDLKGEEGSFRGSVLQRAAKFGSLAKQNSQMIVKRFSFSQRSRDESASETSTPSEHSAAPSPQVEVRTLEGQLVQHPGPGIPRPGHRSRAPELVTKKFPVDLRLPPVVPLPPPTLRELELQRRPTGDFGFSLRRTTMLDRGPEGQACRRVVHFAEPGAGTKDLALGLVPGDRLVEINGHNVESKSRDEIVEMIRQSGDSVRLKVQPIPELSELSRSWLRSGEGPRREPSDAKTEEQIAAEEAWNETEKVWLVHRDGFSLASQLKSEELNLPEGKVRVKLDHDGAILDVDEDDVEKANAPSCDRLEDLASLVYLNESSVLHTLRQRYGASLLHTYAGPSLLVLGPRGAPAVYSEKVMHMFKGCRREDMAPHIYAVAQTAYRAMLMSRQDQSIILLGSSGSGKTTSCQHLVQYLATIAGISGNKVFSVEKWQALYTLLEAFGNSPTIINGNATRFSQILSLDFDQAGQVASASIQTMLLEKLRVARRPASEATFNVFYYLLACGDGTLRTELHLNHLAENNVFGIVPLAKPEEKQKAAQQFSKLQAAMKVLGISPDEQKACWFILAAIYHLGAAGATKEAAEAGRKQFARHEWAQKAAYLLGCSLEELSSAIFKHQHKGGTLQRSTSFRQGPEESGLGDGTGPKLSALECLEGMAAGLYSELFTLLVSLVNRALKSSQHSLCSMMIVDTPGFQNPEQGGSARGASFEELCHNYTQDRLQRLFHERTFVQELERYKEENIELAFDDLEPPTDDSVAAVDQASHQSLVRSLARTDEARGLLWLLEEEALVPGASEDTLLERLFSYYGPQEGDKKGQSPLLHSSKPHHFLLGHSHGTNWVEYNVTGWLNYTKQNPATQNAPRLLQDSQKKIISNLFLGRAGSATVLSGSIAGLEGGSQLALRRATSMRKTFTTGMAAVKKKSLCIQMKLQVDALIDTIKKSKLHFVHCFLPVAEGWAGEPRSASSRRVSSSSELDLPSGDHCEAGLLQLDVPLLRTQLRGSRLLDAMRMYRQGYPDHMVFSEFRRRFDVLAPHLTKKHGRNYIVVDERRAVEELLECLDLEKSSCCMGLSRVFFRAGTLARLEEQRDEQTSRNLTLFQAACRGYLARQHFKKRKIQDLAIRCVQKNIKKNKGVKDWPWWKLFTTVRPLIEVQLSEEQIRNKDEEIQQLRSKLEKAEKERNELRLNSDRLESRISELTSELTDERNTGESASQLLDAETAERLRAEKEMKELQTQYDALKKQMEVMEMEVMEARLIRAAEINGEVDDDDAGGEWRLKYERAVREVDFTKKRLQQEFEDKLEVEQQNKRQLERRLGDLQADSEESQRALQQLKKKCQRLTAELQDTKLHLEGQQVRNHELEKKQRRFDSELSQAHEEAQREKLQREKLQREKDMLLAEAFSLKQQLEEKDMDIAGFTQKVVSLEAELQDISSQESKDEASLAKVKKQLRDLEAKVKDQEEELDEQAGTIQMLEQAKLRLEMEMERMRQTHSKEMESRDEEVEEARQSCQKKLKQMEVQLEEEYEDKQKVLREKRELEGKLATLSDQVNRRDFESEKRLRKDLKRTKALLADAQLMLDHLKNSAPSKREIAQLKNQLEESEFTCAAAVKARKAMEVEIEDLHLQIDDIAKAKTALEEQLSRLQREKNEIQNRLEEDQEDMNELMKKHKAAVAQASRDLAQINDLQAQLEEANKEKQELQEKLQALQSQVEFLEQSMVDKSLVSRQEAKIRELETRLEFERTQVKRLESLASRLKENMEKLTEERDQRIAAENREKEQNKRLQRQLRDTKEEMGELARKEAEASRKKHELEMDLESLEAANQSLQADLKLAFKRIGDLQAAIEDEMESDENEDLINSLQDMVTKYQKRKNKLEGDSDVDSELEDRVDGVKSWLSKNKGPSKAASDDGSLKSSSPTSYWKSLAPDRSDDEHDPLDNTSRPRYSHSYLSDSDTEAKLTETNA DIP protein Q92614 original sequence version: 152 52BFA0AA273E18F7 q9vk31_drome Dmel_CG5439 CG5439 Dmel\CG5439 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPENASSSMPTEAGFRSMRSQLAGSTFGQRREDIFRRLQESAHKISQKFSGKELATERDESVQELCESLEELMSYGLRQSAGTSSFSAASFIQNMQEMVSGNAGGGSNNNDATFWEFCQTHLTPHERQRYMDLKQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSDEEQLHRFYTPWSLLLNDEAAKKLPEIVDSLSDVLFALNVDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLLGALKPIESVEVQQILSKESIEQELAQPQEEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDTSSQWSKSSSSANCLANSQQQAALEEHVNQLNERCALLETRVAELSLQNRLLIRRLTKQFEETGIDPSSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVEACKSKAELQKVFPFFRDR 2BA4F6EBB39AC605 1-phosphatidyl-1d-myo-inositol 4,5-bisphosphate 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) 1-phosphatidyl-1d-myo-inositol 3,4-bisphosphate 1-phosphatidyl-1D-myo-inositol 3,4-bisphosphate small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9vsf0_drome WD repeat domain phosphoinositide-interacting protein 2 Atg18A atg18a CG7986 Dmel_CG7986 Atg18 Atg18a atg18.1 ATG18 ATG18.1 Dmel\CG7986 atg18 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMSLLGRTDVDAGEVFVNFNQNITSLAVATSGGYSLYSLGSVDSTLDKIYHTKSDELFLIERLFESSLVAIVSQRAPRKLKVCHFKKQSEICNYSYANTILAVKLNRERLIVCLEESLYIHNIQDMKVVHTIRDTPCNPQGLCALSSSSEHCYLAYPGSVTAGEVQIFDAINLHAKTMIPAHDTPLAALAFSPSGTEIATASERGTVIRVFSSQDGSRLFELRRGLKRCVSIVSLSFSTCAEYLVSSSNTETVHIFRLDRSATETAEGHGSKQSSDDWMGYSFFRFLSKTVTSYLPTQVTDVFSQGRAFASVTLPEAGVRRMCAIATIQKQLRLLIASQDGYLYVYSIPTVEGAECQLIKRHDLRLEDHYAMDIKGA 5FA23085C6454F29 1-phosphatidyl-1d-myo-inositol 3,4,5-trisphosphate 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphates small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) q9y128_drome Ceramide transfer protein Collagen type IV alpha-3-binding protein cert BcDNA.GH07688 BcDNA:GH07688 CERT Dcert Dmel\CG7207 dcert Dmel_CG7207 CG7207 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MDTNAGESLGASPPSSNEAAAGSQSQSDASEEEEYLDNSIELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYKADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSEDQSKKLKDEVEKMKRLSYPGPDFEEGPHSTLPEDEFFDAVETGLDKIEEDMQLRFKLKLQSQISQTLVNVPHEAVAEGEEAREEFGTGAEATSHALWPEIDRVCKEQLHYAREGVGQDGNGWQIFADEGEIKMYKREEEVNGLVMDPLKAYHTVQGVTAREMCHYFFMPEFRNDWETTLEDCTILEKISADTLLFLQTHKRIWPASQRDAQFWSHMRKITDNLEPGARDMWVVCNNSTEYAKQESKNGKCVRIFLTVILACQTHLPEGYVKGQPLNRNDLTCKITYCSVVNPGGWAPASALRAVYKREYPKFLKRFTGYVIDQCKDKPIMF 387755EFCE23DB60 pa-snx29-1 2 16 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 1A pi4p-vps74-1 2 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 1A pi3p-snx29-1 2 18 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 1 pi4p-golph3-1 2 15 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Figs. 1A, 2A Sequence of Q9VQ93 is one amino acid longer than the length of GOLPH3 given in the text. pi4p-golph3-2 2 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 1A pi35p-atg18-1 2 12 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 1A pi45p-tubby-1 2 13 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 19 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 1A pi34p-akt1-1 2 20 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 1A pi345p-akt1-1 2 7 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 22 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 1 pi4p-cert-1 2 9 unspecified role unspecified role bait bait 23 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction Fig. 1 pi3p-sara-1 2 8 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 1 pi3p-atg18-1 2 21 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait direct interaction direct interaction Fig. 1A pi4p-golph3-3 5 11 unspecified role unspecified role prey prey Q9H4A6:p.[Arg171Ala;Arg174Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A certain certain sequence position certain certain certain sequence position certain R A Fri Jul 22 11:02:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg174ala,arg171ala' Wed May 02 18:51:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg171ala,arg174ala' Tue Jun 30 17:28:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg171Ala;Arg174Ala]' Q9H4A6:p.Arg90Leu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R L Wed May 02 15:14:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg90leu' Tue Jun 30 17:02:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg90Leu' in vitro In vitro 9 unspecified role unspecified role bait bait direct interaction direct interaction Figs. 2D Lipid vesicle binding shows specificity of wild-type GOLPH3 for PtdIns(4)P golph3-myo18a 6 11 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association To confirm the interaction between GOLPH3 and MYO18A, we IP'd GOLPH3 from whole cell lysates and Western blotted with a MYO18A-specific antibody Fig. 4C golph3-myo18a-1 3 17 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region SUMO tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction Purified, bacterial expressed GOLPH3 (but not GST) binds His-SUMO-tagged N-terminal and middle fragments of MYO18A but not C-terminal fragment or His-SUMO alone bound to Ni beads. Fig. 4E golph3-myo18a-2 1 11 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component colocalization colocalization MYO18A (green) colocalizes with GOLPH3 (red) Fig. 4F The Golgi protein GOLGA4 was searately shown to localise in the same region. Knockdown of GOLPH3 causes loss of MYO18A from Golgi pi4p-golph3-4 2 15 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait direct interaction direct interaction Supp. Fig. 1 Bacterial expressed and purified GST fusions of Drosophila and human GOLPH3 specifically bind PtdIns(4)P in vitro by lipid blot assay. pi4p-golph3-5 2 9 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 1 Bacterial expressed and purified GST fusions of Drosophila and human GOLPH3 specifically bind PtdIns(4)P in vitro by lipid blot assay. golph3-myo18a-3 4 11 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association Large-scale immunoprecipitation of GOLPH3 coprecipitates MYO18A. Supp. Fig. 12