IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma pull down pull down de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 human-bph1 Human BPH1 cells bph1 BPH-1 benign hyperplastic prostatic epithelial cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 human-h460 Homo sapiens non-small-cell lung cancer cell line H460 h460 human non-small-cell lung cancer cell line H460 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell surface proteins were biotinylated using cell-impermeable sulfo-NHS-LC-biotin. Participants were identified by anti-bait, anti-tag and avidin-HRP blots. vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell were pre-treated with TRAIL. Cell surface proteins were biotinylated using cell-impermeable sulfo-NHS-LC-biotin. Participants were identified by anti-bait, anti-tag and avidin-HRP blots. vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma confocal microscopy confocal microscopy immunostaining immunostaining Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. The tumor suppressor Par-4 activates an extrinsic pathway for apoptosis. Cell (0092-8674) 2009 imex curation Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions 14 human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Burikhanov R., Zhao Y., Goswami A., Qiu S., Schwarze SR., Rangnekar VM. Apoptosis - Interactions involving proteins with a function related to apoptosis vmrang01@email.uky.edu Accepted 2009-SEP-18 by DAVET. Cell (0092-8674) 2009 davet Only protein-protein interactions 14 imex curation top1_human DNA topoisomerase 1 DNA topoisomerase I TOP1 protein protein human Homo sapiens Human MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF DIP protein P11387 original sequence version: 189 6FBED540BCF7BE28 casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F pawr_human PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein PAWR PAR4 protein protein human Homo sapiens Human MATGGYRTSSGLGGSTTDFLEEWKAKREKMRAKQNPPGPAPPGGGSSDAAGKPPAGALGTPAAAAANELNNNLPGGAPAAPAVPGPGGVNCAVGSAMLTRAAPGPRRSEDEPPAASASAAPPPQRDEEEPDGVPEKGKSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKTLLKVVGQLTR DIP protein Q96IZ0 original sequence version: 31 DIP protein Q96IZ0 original sequence version: 110 7E7515455402DBF8 bip_human Endoplasmic reticulum chaperone BiP HSPA5 GRP78 Immunoglobulin heavy chain-binding protein 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein human Homo sapiens Human MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL DIP protein P11021 original sequence version: 127 DIP protein P11021 original sequence version: 137 DIP protein P11021 original sequence version: 185 59B7D8D85BC32A00 cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 pawr_rat PRKC apoptosis WT1 regulator protein Prostate apoptosis response 4 protein Transcriptional repressor Par-4-like protein PAWR Pawr Par4 protein protein rat Rattus norvegicus (Rat) Rat MATGGYRSSGSTTDFLEEWKAKREKMRAKQNPVGPGSSGGDPAAKSPAGPLAQTTAAGTSELNHGPAGAAAPAAPGPGALNCAHGSSALPRGAPGSRRPEDECPIAAGAAGAPASRGDEEEPDSAPEKGRSSGPSARKGKGQIEKRKLREKRRSTGVVNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAASLPDPGTSYLPQDPSRTVPGRYKSTISAPEEEILNRYPRTDRSGFSRHNRDTSAPANFASSSTLEKRIEDLEKEVLRERQENLRLTRLMQDKEEMIGKLKEEIDLLNRDLDDMEDENEQLKQENKTLLKVVGQLTR 2069B32DEFFF160F pawr-hspa5-1 9 13 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait physical association physical association Seeking confirmation that endogenous GRP78 binds Par-4 in mammalian cells, we used PC-3 whole-cell lysates for coimmunoprecipitations with GFP, Par-4, or GRP78 antibodies, followed by immunoblotting for Par-4 or GRP78. Figs. 3A, 3B, Supp. Fig. 3F, Supp. Fig. 7C When cells are pre-treated with TRAIL, the interaction is enriched in the membrane fraction. pawr-hspa5-2 9 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Seeking confirmation that endogenous GRP78 binds Par-4 in mammalian cells, we used PC-3 whole-cell lysates for coimmunoprecipitations with GFP, Par-4, or GRP78 antibodies, followed by immunoblotting for Par-4 or GRP78. Fig. 3A, Supp. Fig. 3F When cells are pre-treated with TRAIL, the interaction is enriched in the membrane fraction. pawr-hspa5-3 7 15 unspecified role unspecified role bait bait sac region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey physical association physical association PC-3 cells were transfected with GFP, Par-4-GFP, or SAC-GFP expression constructs or left untransfected, and the cell lysates were subjected to immunoprecipitation (IP) with Par-4 or GFP antibody. Fig. 3B pawr-hspa5-4 4 15 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Thioredoxin fusion fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma physical association physical association Moreover, TRX-Par-4 but not TRX control protein, pulled-down biotinylated GRP78 Figs. 3D Labelling with cell-impermeable sulfo-NHS-LC-biotin and then performing an avidinn-HRP blot, indicated proteins were interacting at the cell surface. pawr-hspa5-5 5 12 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma physical association physical association The GRP78 antibody, as well as the Par-4 antibody, coimmunoprecipitated biotinylated Par-4 and biotinylated GRP78 (Figure 3D). Figs. 3D Labelling with cell-impermeable sulfo-NHS-LC-biotin and then performing an avidinn-HRP blot, indicated proteins were interacting at the cell surface. pawr-hspa5-6 5 13 unspecified role unspecified role bait bait region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma 12 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association The GRP78 antibody, as well as the Par-4 antibody, coimmunoprecipitated biotinylated Par-4 and biotinylated GRP78 (Figure 3D). Figs. 3D Labelling with cell-impermeable sulfo-NHS-LC-biotin and then performing an avidinn-HRP blot, indicated proteins were interacting at the cell surface. pawr-hspa5-7 8 12 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization As seen in Figure 3E, PC-3 and BPH-1 cells treated with vehicle showed colocalization of Par-4 and GRP78 in the ER. Figs. 3E, Supp. Figs. 3C, 3E Upon treatment with TRAIL, Par-4 colocalized with GRP78 at the plasma membrane. pawr-hspa5-8 2 13 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization As seen in Figure 3E, PC-3 and BPH-1 cells treated with vehicle showed colocalization of Par-4 and GRP78 in the ER. Figs. 3E, Supp. Figs. 3C, 3E pawr-hspa5-9 1 13 unspecified role unspecified role prey prey human-pc3 Human PC3 Caucasian prostate adenocarcinoma pc3 Human Caucasian prostate adenocarcinoma 10 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association Supp. Figs. 2A, 2C, Supp. Table 1 pawr-hspa5-10 4 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait sac region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association For verification, the proteins pulled down from the PC-3 lysates were subjected to western blot analysis for GRP78; His-SAC-GFP, but not the His-GFP control, pulled down GRP78 protein from PC-3 cells (Figure S2B). Supp. Fig. 2B casp8-hspa5-1 8 11 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization A total of 400 cells were scored for co-localization of active caspase-8 and GRP78 at the cell membrane in 30 minutes in each experiment, Supp. Fig. 8D TRAIL + PAR4 cav1-hspa5-1 8 14 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization Nuclei were revealed by DAPI staining. Co-localization (yellow or yellowishorange fluorescence in overlay images) of GRP78 and caveolin-1 at the cell membrane was examined by confocal microscopy. Supp. Fig. 9 TRAIL + PAR4 pawr-hspa5-11 6 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association We confirmed in lung and cervical cancer cells (H460 and HeLa cells, respectively) that: (1) TRAIL causes secretion of Par-4 (Figure S11A); (2) TRAIL induces expression of GRP78 but not Par-4 (Figure S11B); (3) Par-4 binds to GRP78 (Figure S11C); Supp. Fig. 11 pawr-hspa5-12 3 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association We confirmed in lung and cervical cancer cells (H460 and HeLa cells, respectively) that: (1) TRAIL causes secretion of Par-4 (Figure S11A); (2) TRAIL induces expression of GRP78 but not Par-4 (Figure S11B); (3) Par-4 binds to GRP78 (Figure S11C); Supp. Fig. 11