IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Cancer Cell (1535-6108) 2009 imex curation Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer simeone@umich.edu 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis simeone@umich.edu Accepted 2010-MAR-11 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Cancer Cell (1535-6108) 2009 imex curation Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer simeone@umich.edu 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 human-bxpc3 Homo sapiens primary pancreatic adenocarcinoma cell line bxpc3 BxPC-3 Human primary pancreatic adenocarcinoma cell line Derived from a 61 year old female with a primary adenocarcinoma of the pancreas. BxPC-3 cells produce mucin and the tumour in a nude mouse is moderately well to poorly differentiated like the primary adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis simeone@umich.edu Accepted 2010-MAR-11 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Cancer Cell (1535-6108) 2009 imex curation Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer simeone@umich.edu 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis simeone@umich.edu Accepted 2010-MAR-11 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Cancer Cell (1535-6108) 2009 imex curation Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer simeone@umich.edu 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 human-panc1 Homo sapiens pancreatic carcinoma cell line PANC-1 panc1 Human pancreatic carcinoma cell line PANC-1 Established from a pancreatic carcinoma of ductal origin from a 56-year-old Caucasian male. Cells possess the type B phenotype for G6PD. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis simeone@umich.edu Accepted 2010-MAR-11 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Oncogenic function of ATDC in pancreatic cancer through Wnt pathway activation and beta-catenin stabilization. Cancer Cell (1535-6108) 2009 imex curation Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer simeone@umich.edu 23-Feb-2010: Contacted by JYOTI. orchard Only protein-protein interactions 9 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wang L., Heidt DG., Lee CJ., Yang H., Logsdon CD., Zhang L., Fearon ER., Ljungman M., Simeone DM. Apoptosis - Interactions involving proteins with a function related to apoptosis Additional details of construct supplied by author. simeone@umich.edu Accepted 2010-MAR-11 by ORCHARD. 23-Feb-2010: Contacted by JYOTI. Cancer Cell (1535-6108) 2009 orchard Only protein-protein interactions 9 imex curation axin1_human Axin-1 Axis inhibition protein 1 AXIN1 AXIN protein protein human Homo sapiens Human MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD DIP protein O15169 original sequence version: 118 DIP protein O15169 original sequence version: 125 DIP protein O15169-1 original sequence version: 140 DIP protein O15169 original sequence version: 132 10779173F5092F3F tri29_human Tripartite motif-containing protein 29 Ataxia telangiectasia group D-associated protein TRIM29 ATDC protein protein human Homo sapiens Human MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSALKPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVTFAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNKQKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQTCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKSFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHEDKQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVCMRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGGVRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFSLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP 7CBAD7A4C43A311C gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 dvl2_human Segment polarity protein dishevelled homolog DVL-2 DSH homolog 2 DVL2 protein protein human Homo sapiens Human MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM DIP protein O14641 original sequence version: 150 DIP protein O14641 original sequence version: 113 DIP protein O14641 original sequence version: 124 DIP protein O14641 original sequence version: 154 DIP protein O14641 original sequence version: 159 4BAD95B6C3FE531B axin-trim29 3 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association no location found for flag-tag. In coimmunoprecipitation experiments using antibodies directed against axin, GSK-3beta, and beta-catenin, evidence of complexes containing ATDC and axin and complexes containing ATDC and GSK-3beta was observed in HEK293 cells transfected with a FLAG-tagged ATDC construct. Fig 6C. axin-gskb 3 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association In coimmunoprecipitation experiments using antibodies directed against axin, GSK-3beta, and beta-catenin, evidence of complexes containing ATDC and axin and complexes containing ATDC and GSK-3beta was observed in HEK293 cells transfected with a FLAG-tagged ATDC construct. Fig 6C. axin-trim29-2 2 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig 6D. We tested the ability of endogenous ATDC in BxPC3 cells to interact with axin and GSK-3beta, and similar results were obtained. axin-gskb-1 2 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig 6D. We tested the ability of endogenous ATDC in BxPC3 cells to interact with axin and GSK-3beta, and similar results were obtained. axin-dvl2-1 3 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 6I. Coimmunoprecipitation experiments in HEK293 cells and BxPC3 cells demonstrated that ATDC formed a complex with Dvl-2. axin-dvl2 2 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig 6J. Coimmunoprecipitation experiments in HEK293 cells and BxPC3 cells demonstrated that ATDC formed a complex with Dvl-2. axin-dvl2-2 5 9 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait range sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supplementary Fig S6. We found that the ATDC Delta220 and ATDC Delta260 deletion mutants were able to interact with Dvl-2 while the ATDC Delta348 mutant was not, suggesting that amino acids 260�348 of ATDC, in a region that contains a coiled-coil domain, interact with Dvl-2. axin-dvl2-3 1 9 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization Supplementary Fig S5. Immunohistochemical analysis revealed colocalization of ATDC and Dvl-2 in ATDC-transfected HEK293 cells. axin-dvl2-4 4 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component colocalization colocalization Supplementary Fig S5. Immunohistochemical analysis revealed colocalization of ATDC and Dvl-2 in ATDC-transfected Panc1 cells.