UniProt UniProt http://www.uniprot.org Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Mol. Cells (1016-8478) 2008 imex curation Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. human fetal brain cDNA jyoti Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis the used antidody according supplier: "epitope mapping at the N-terminus of BimEL of human origin"; "recommended for detection of BimEL, BimL and BimS of m, r and h origin by WB, IF and ELISA". problem is that the n-ter is identical for all isoforms - 17! in SP. in the case here they transfected BimL it seems reasonable to give BimL as interactant. shaohuaghu@fudan.edu.cn Accepted 2008-Not a month!-29 by JYOTI. 03-Mar-2009: Contacted by JYOTI. human fetal brain cDNA Mol. Cells (1016-8478) 2008 jyoti Only protein-protein interactions imex curation Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Mol. Cells (1016-8478) 2008 imex curation Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. human fetal brain cDNA jyoti Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis the used antidody according supplier: "epitope mapping at the N-terminus of BimEL of human origin"; "recommended for detection of BimEL, BimL and BimS of m, r and h origin by WB, IF and ELISA". problem is that the n-ter is identical for all isoforms - 17! in SP. I followed isoform indications in fig 2, but put a caution Normal or diamide-treated (apoptotic) K562 cells have been used. shaohuaghu@fudan.edu.cn Accepted 2008-Not a month!-29 by JYOTI. 03-Mar-2009: Contacted by JYOTI. human fetal brain cDNA Mol. Cells (1016-8478) 2008 jyoti Only protein-protein interactions imex curation Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Mol. Cells (1016-8478) 2008 imex curation Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. human fetal brain cDNA jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn Accepted 2008-Not a month!-29 by JYOTI. 03-Mar-2009: Contacted by JYOTI. human fetal brain cDNA Mol. Cells (1016-8478) 2008 jyoti Only protein-protein interactions imex curation Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Mol. Cells (1016-8478) 2008 imex curation Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. human fetal brain cDNA jyoti Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn Accepted 2008-Not a month!-29 by JYOTI. 03-Mar-2009: Contacted by JYOTI. human fetal brain cDNA Mol. Cells (1016-8478) 2008 jyoti Only protein-protein interactions imex curation Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Macrophage Migration Inhibitory Factor (MIF) Interacts with Bim and Inhibits Bim-mediated Apoptosis. Mol. Cells (1016-8478) 2008 imex curation Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis shaohuaghu@fudan.edu.cn 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. human fetal brain cDNA jyoti Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu L., Chen J., Ji C., Zhang J., Sun J., Li Y., Xie Y., Gu S., Mao Y. Apoptosis - Interactions involving proteins with a function related to apoptosis Fig 1A shows a weak interaction of MIF with an isoform called BIM beta5 and refering to AY305716. AY305716 is not integrated into UniProt, in the original paper for this isoform, PMID:15147734, the isoform is judged as ambigous and is not further investigated. Note that UniProt BIM beta5 isoform (O43521-14, originating from PMID:17503221) is different. shaohuaghu@fudan.edu.cn Accepted 2008-Not a month!-29 by JYOTI. 03-Mar-2009: Contacted by JYOTI. human fetal brain cDNA Mol. Cells (1016-8478) 2008 jyoti Only protein-protein interactions imex curation o54918-3 Bcl-2-like protein 11 Bcl2l11 Bim Bcl2-interacting mediator of cell death protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH DIP protein O54918-3 original sequence version: 57 67AB421AC1E4D2CA o43521-1 Bcl-2-like protein 11 Bim(EL) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH D75735E469CA6997 o43521-5 Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death Bim-ACD BimACD protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK 4335FA21C13B49AD o43521-3 Bcl-2-like protein 11 Bim(S) BCL2-like 11 transcript variant 9 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH 60067208524D5BEA mif_human Macrophage migration inhibitory factor MIF MMIF GLIF Phenylpyruvate tautomerase Glycosylation-inhibiting factor L-dopachrome tautomerase L-dopachrome isomerase protein protein human Homo sapiens Human MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA DIP protein P14174 original sequence version: 138 DIP protein P14174 original sequence version: 186 56D51107C05286B2 o43521-2 Bcl-2-like protein 11 Bim(L) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH 8BB4AAE06CB080FA o43521-6 Bcl-2-like protein 11 BCL2-like 11 transcript variant 10 BCL2L11 BIM Bcl2-interacting mediator of cell death Bim-AD BimAD protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK 3E03CCF2154A242C mif-biml 4 11 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 1B mif-biml-1 1 11 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 unspecified role unspecified role bait bait human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 2A Several Bim isoforms could be immunoprecipated but the identity of the isoforms cannot be established with the goat anti-Bim (N20) antibody used for immunoblotting. Isoform BimL (which was transfected) is given as the most prominent coimmunoprecipitated form. Additional bands are indicated as isoform BimEL (O43521-1) and isoform BimS (O43521-3). P14174; O43521-2 transfection mif-biml-2 2 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 2B Several Bim isoforms could be immunoprecipated but the identity of the isoforms cannot be unambigously established with the goat anti-Bim (N20) antibody used for immunoblotting. The authors refer to isoform (BimL O43521-2) (the most prominent coimmunoprecipitated form), isoform BimEL (O43521-1) and isoform BimS (O43521-3). The curation tentatively followed the authors statement. The interaction was increased in apoptotic cells. bcl2ll1-mif 3 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association no fig SP mapping using AF032458 for isoform BimL bcl2ll1-mif-1 5 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 1A sp mapping using AAC39594 for isoform bimL bcl2ll1-mif-2 5 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 1A SP mapping using AF032461 for isoform bimS bcl2ll1-mif-3 5 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1A sp mapping using AB071198 for isoform bimalpha2 mif-biml-3 2 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 2B Several Bim isoforms could be immunoprecipated but the identity of the isoforms cannot be unambigously established with the goat anti-Bim (N20) antibody used for immunoblotting. The authors refer to isoform (BimL O43521-2) (the most prominent coimmunoprecipitated form), isoform BimEL (O43521-1) and isoform BimS (O43521-3). The curation tentatively followed the authors statement. mif-biml-4 2 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 2B Several Bim isoforms could be immunoprecipated but the identity of the isoforms cannot be unambigously established with the goat anti-Bim (N20) antibody used for immunoblotting. The authors refer to isoform (BimL O43521-2) (the most prominent coimmunoprecipitated form), isoform BimEL (O43521-1) and isoform BimS (O43521-3). The curation tentatively followed the authors statement. bcl2ll1-mif-4 5 12 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1A sp mapping using AY305715 for isoform bimalpha3 The interaction has been shown to be weak/unstable.