IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Cell (0092-8674) 2008 imex curation Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA davet Only protein-protein interactions 8 mouse-embryonic_stem cell Mus musculus embryonic stem cell es cells embryonic stem cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu Accepted 2008-SEP-20 by DAVET. 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 8 imex curation Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Cell (0092-8674) 2008 imex curation Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA davet Only protein-protein interactions 8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu Accepted 2008-SEP-20 by DAVET. 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 8 imex curation Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Cell (0092-8674) 2008 imex curation Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA davet Only protein-protein interactions 8 yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu Accepted 2008-SEP-20 by DAVET. 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 8 imex curation Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Cell (0092-8674) 2008 imex curation Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA davet Only protein-protein interactions 8 human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu Accepted 2008-SEP-20 by DAVET. 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 8 imex curation Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Ronin is essential for embryogenesis and the pluripotency of mouse embryonic stem cells. Cell (0092-8674) 2008 imex curation Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA davet Only protein-protein interactions 8 in vitro In vitro protease assay protease assay weight by staining molecular weight estimation by staining weight by staining Dejosez M., Krumenacker JS., Zitur LJ., Passeri M., Chu LF., Songyang Z., Thomson JA., Zwaka TP. Apoptosis - Interactions involving proteins with a function related to apoptosis tpzwaka@bcm.edu Accepted 2008-SEP-20 by DAVET. 16-Oct-2008: Contacted by JYOTI. Human embryonic stem cell cDNA Cell (0092-8674) 2008 davet Only protein-protein interactions 8 imex curation hcfc1_human Host cell factor 1 HCFC1 HCF1 C1 factor VP16 accessory protein VCAF CFF HFC1 protein protein human Homo sapiens Human MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAATATSPTPNPVPSVPANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVPGSSISVPTAARTQGVPAVLKVTGPQATTGTPLVTMRPASQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSSPQMSGMAALAAAAAATQKIPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPVMVSNPATRMLKTAAAQVGTSVSSATNTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKTITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGTILKLVTSADGKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQAGATGVTSSPGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPGQPGTILRTVPMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGHSTSASLATPITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQVTLITAPSGVEAQPVHDLPVSILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCETHETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPCETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACAAGTPAVIRISVATGALEAAQGSKSQCQTRQTSATSTTMTVMATGAPCSAGPLLGPSMAREPGGRSPAFVQLAPLSSKVRLSSPSIKDLPAGRHSHAVSTAAMTRSSVGAGEPRMAPVCESLQGGSPSTTVTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNPPCETHETGTTHTATTATSNGGTGQPEGGQQPPAGRPCETHQTTSTGTTMSVSVGALLPDATSSHRTVESGLEVAAAPSVTPQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNMSSNQDPPPAASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVPPPEELQVSPGPRQQLPPRQLLQSASTALMGESAEVLSASQTPELPAAVDLSSTGEPSSGQESAGSAVVATVVVQPPPPTQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEAAAQAAATEEAQALAIQAVLQAAQQAVMGTGEPMDTSEAAATVTQAELGHLSAEGQEGQATTIPIVLTQQELAALVQQQQLQEAQAQQQHHHLPTEALAPADSLNDPAIESNCLNELAGTVPSTVALLPSTATESLAPSNTFVAPQPVVVASPAKLQAAATLTEVANGIESLGVKPDLPPPPSKAPMKKENQWFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQAGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADGQ 0B0C581E2454631E gata6_mouse_gene Mouse Gata6 gene gene gene mouse Mus musculus Mouse casp3_mouse Caspase-3 Casp3 Cpp32 Apopain Cysteine protease CPP32 Protein Yama SREBP cleavage activity 1 LICE protein protein mouse Mus musculus Mouse MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH DIP protein P70677 original sequence version: 99 DIP protein P70677 original sequence version: 110 CE91598F74826605 sin3a_human Paired amphipathic helix protein Sin3a SIN3A Transcriptional corepressor Sin3a Histone deacetylase complex subunit Sin3a protein protein human Homo sapiens Human MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPSQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATEGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLAQKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGTVFKAP DIP protein Q96ST3 original sequence version: 128 DIP protein Q96ST3 original sequence version: 147 E6A329BE0EAD84CD hdac3_human Histone deacetylase 3 HDAC3 RPD3-2 SMAP45 protein protein human Homo sapiens Human MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI DIP protein O15379 original sequence version: 159 DIP protein O15379 original sequence version: 161 DIP protein O15379 original sequence version: 162 DIP protein O15379 original sequence version: 89 DIP protein O15379 original sequence version: 156 DIP protein O15379 original sequence version: 176 DIP protein O15379 original sequence version: 170 DIP protein O15379-1 original sequence version: 170 DIP protein O15379 original sequence version: 127 DIP protein O15379-1 original sequence version: 128 DIP protein O15379 original sequence version: 119 94485C1EBDCF5AD0 thap7_human THAP domain-containing protein 7 THAP7 protein protein human Homo sapiens Human MPRHCSAAGCCTRDTRETRNRGISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEEDCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPAEVSRLRRCRKRCSEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSDLLGPLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQNEHSYQVGSALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQERAREKRAQADARQTLKEHVQDFAMQLSSSMA 7B58685CA759D424 gata4_mouse_gene Mouse gata4 gene gene gene mouse Mus musculus Mouse tha11_human THAP domain-containing protein 11 THAP11 HRIHFB2206 protein protein human Homo sapiens Human MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQSSPSASTAQTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELQAATAGLEAAECPMGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM 25235D20CB54D8C2 25235D20CB54D8C2 tha11_mouse THAP domain-containing protein 11 Thap11 MNCb-2032 Ronin protein protein mouse Mus musculus Mouse MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQLQQQQPSPSSSTAQTTQLQPNLVSASAAVLLTLQAAVDSNQAPGSVVPVSTTPSGDDVKPIDLTVQVEFAAAEGAAAAAAASELEAATAGLEAAECTLGPQLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM 8586597DABC8601A oct4_mouse_gene Mouse Oct4 gene gene gene mouse Mus musculus Mouse casp3-thap11-1 2 13 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait P70677:p.Cys163Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:46:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ser' Tue Jun 30 19:34:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ser' physical association physical association Identification of Ronin by Yeast Two-Hybrid Screening trapp11-gata4-1 1 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association Ronin binds to the 3x sequence present in the promoter regions of GATA4 and GATA6. Trap11 binds to the 3x promoter region of this gene, Histone H3 is methylated. Fig. 6E trapp11-gata6-1 1 7 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association Ronin binds to the 3x sequence present in the promoter regions of GATA4 and GATA6. Trap11 binds to the 3x promoter region of this gene, Histone H3 is methylated. Fig. 6E trapp11-ot4-1 1 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait association association we also identified a putative DNA-binding sequence for Ronin in the promoter region of Oct4, and indeed Ronin did bind to this region, but only in differentiated ES cells; Trap11 binds to the 3x promoter region of this gene, but only in differentiated ES cells Fig. 6E thap11-hcp1-1 3 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 33 31 physical association physical association Directional yeast two-hybrid approach to detect direct interaction of Ronin, Ronin-C, and Ronin-N with candidate interacting proteins identified by mass spectometry. Direct interaction of Ronin-C with HCF-1 Fig. 7A Human THAP11 is only 313 amino acids long as desribed in UniProtKB, not 315 as given in the paper thap11-hcp1-2 4 13 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association GST-tagged variants of Ronin, Ronin-C or Ronin-N, and with Myc-tagged variants of the putative interaction partners. Using this strategy, we confirmed the binding of Ronin to HCF-1 via the C terminus. Fig. 7D P51610; Q96EK4 transfection thap11-thap11-1 4 13 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 43 46 physical association physical association Other confirmed protein interaction partners (Figure 7D) were Ronin itself (via homodimerization through the C terminus); THAP7, another THAP domain protein (via heterodimerization through the N terminus); and Sin3A (C terminus) and HDAC3 (N terminus) Fig. 7D Q96EK4 transfection thap11-sin3a-1 4 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 50 53 physical association physical association Other confirmed protein interaction partners (Figure 7D) were Ronin itself (via homodimerization through the C terminus); THAP7, another THAP domain protein (via heterodimerization through the N terminus); and Sin3A (C terminus) and HDAC3 (N terminus) Fig. 7D Q96EK4; Q96ST3 transfection thap11-thap7-1 4 13 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Other confirmed protein interaction partners (Figure 7D) were Ronin itself (via homodimerization through the C terminus); THAP7, another THAP domain protein (via heterodimerization through the N terminus); and Sin3A (C terminus) and HDAC3 (N terminus) Fig. 7D Q9BT49; Q96EK4 transfection thap11-hdac3-1 4 13 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Other confirmed protein interaction partners (Figure 7D) were Ronin itself (via homodimerization through the C terminus); THAP7, another THAP domain protein (via heterodimerization through the N terminus); and Sin3A (C terminus) and HDAC3 (N terminus) Fig. 7D O15379; Q96EK4 transfection casp3-thap11-2 5 8 enzyme enzyme neutral component neutral component P70677:p.Cys163Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 19:16:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys163ser' Tue Jun 30 17:23:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys163Ser' 13 enzyme target enzyme target substrate substrate neutral component neutral component protein cleavage protein cleavage Cleavage of THAP11 (Q96EK4) Supp. Fig. 1A The reduction of the molecular size of the full length Ronin and the appearance of an additional smaller band are indicative for Caspase-3 mediated cleavage of Ronin