UniProt UniProt http://www.uniprot.org Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions mouse-nfs56 Mus musculus myeloid leukemia cell line NFS56 nfs56 myeloid leukemia cell lines NFS56 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis 293T cells, stably expressing TAP-tagged mouse MBD3, were transiently transfected (or not) with HA-tagged EVi1 plasmid. h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions mouse-32d Mouse 32d bone marrow cells 32d established from long-term bone marrow cultures of C3H/HeJ mice infected with the Friend murine leukemia virus; cells are constitutively growth factor-dependent molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis 293T cells, stably expressing TAP-tagged mouse MBD3, were transiently transfected with HA-tagged EVi1 plasmid. h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Myeloid transforming protein Evi1 interacts with methyl-CpG binding domain protein 3 and inhibits in vitro histone deacetylation by Mbd3/Mi-2/NuRD. Biochemistry (0006-2960) 2008 imex curation Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl 14-Nov-2008: Contacted by JYOTI. mouse 17 day total embryo cDNA (Clontech) orchard Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Spensberger D., Vermeulen M., Le Guezennec X., Beekman R., van Hoven A., Bindels E., Stunnenberg H., Delwel R. Apoptosis - Interactions involving proteins with a function related to apoptosis h.delwel@erasmusmc.nl Accepted 2008-NOV-1 by ORCHARD. mouse 17 day total embryo cDNA (Clontech) Biochemistry (0006-2960) 2008 orchard Only protein-protein interactions imex curation mecom_mouse Histone-lysine N-methyltransferase MECOM Mds1 Myelodysplasia syndrome 1 protein homolog Mecom Evi1 Ecotropic virus integration site 1 protein MDS1 and EVI1 complex locus protein Prdm3 protein protein mouse Mus musculus Mouse MRSKGRARKLATSNECAYGNYPEIPLEEMPDADADGITSVPSLHIQEPCSPATSSESFTPKEGSPYKAPIYIPDDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLKDSSYGWEILDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMKSEEDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDLQQNLESESDLREIHGNQDCKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGTNRHPAGLTFPTAPGFSFSFPGLFPSGLYHRPPLIPASPPVKGLSSTEQSNKCQSPLLTHPQILPATQDILKALSKHPPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDLESDKEKCKENGKMFKDKVSPLQNLASITNKKEHNNHSVFSASVEEQSAVSGAVNDSIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPSEVKKLQKGSSESPFDLTTKRKDEKPLTSGPSKPSGTPATSQDQPLDLSMGSRGRASGTKLTEPRKNHVFGEKKGSNMDTRPSSDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSMFSFRAPPNTLPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESAGAILDDKEDAYFTEIRNFIGNSNHGSQSPRNMEERMNGSHFKDKKALATSQNSDLLDDEEVEDEVLLDEEDEDNDIPGKPRKELGVTRLDEEIPEDDYEEAGALEMSCKASPVRYKEEDYKSGLSALDHIRHFTDSLKMREMEENQYTDAELSSISSSHVPEELKQTLHRKSKSQAYAMMLSLSDKDSLHPTSHSSSNVWHSMARAAAESSAIQSISHV DIP protein P14404 original sequence version: 117 044BB6F19DBD1403 rbbp7_human Histone-binding protein RBBP7 RBBP7 RBAP46 Retinoblastoma-binding protein 7 Retinoblastoma-binding protein p46 Histone acetyltransferase type B subunit 2 Nucleosome-remodeling factor subunit RBAP46 protein protein human Homo sapiens Human MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS DIP protein Q16576 original sequence version: 75 DIP protein Q16576 original sequence version: 136 DIP protein Q16576 original sequence version: 97 DIP protein Q16576 original sequence version: 102 DIP protein Q16576 original sequence version: 145 DIP protein Q16576 original sequence version: 116 DIP protein Q16576 original sequence version: 96 1A4B4CD1A8E96815 q9z2d8-1 Methyl-CpG-binding domain protein 3 Mbd3 Methyl-CpG-binding protein MBD3 protein protein mouse Mus musculus Mouse MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSAIASALHTSTLPITGQLSAAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEEEEEEEEEEEEPEPERV E4E57BD48463643F mta2_human Metastasis-associated protein MTA2 MTA2 MTA1L1 PID Metastasis-associated 1-like 1 p53 target protein in deacetylase complex protein protein human Homo sapiens Human MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAGFQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAARRPYAPINANAIKAECSIRLPKAAKTPLKIHPLVRLPLATIVKDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPADAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPVPLPAPSHPASTNEPIVLED DIP protein O94776 original sequence version: 128 DIP protein O94776 original sequence version: 122 DIP protein O94776 original sequence version: 85 DIP protein O94776 original sequence version: 120 DIP protein O94776 original sequence version: 130 DIP protein O94776 original sequence version: 146 65087AF798BA64EC mbd3_human Methyl-CpG-binding domain protein 3 MBD3 Methyl-CpG-binding protein MBD3 protein protein human Homo sapiens Human MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEDDDEEDEEEEEEEPDPDPEMEHV DIP protein O95983 original sequence version: 106 B62134DD1BEB636B hdac2_human Histone deacetylase 2 HDAC2 protein protein human Homo sapiens Human MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP DIP protein Q92769 original sequence version: 161 DIP protein Q92769 original sequence version: 154 DIP protein Q92769 original sequence version: 117 DIP protein Q92769 original sequence version: 113 DIP protein Q92769 original sequence version: 139 DIP protein Q92769 original sequence version: 163 DIP protein Q92769 original sequence version: 179 DIP protein Q92769 original sequence version: 153 DIP protein Q92769 original sequence version: 112 775419CCCDAE07FA mbd3_mouse Methyl-CpG-binding domain protein 3 Mbd3 Methyl-CpG-binding protein MBD3 protein protein mouse Mus musculus Mouse MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVKSDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSAIASALHTSTLPITGQLSAAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQEELVQQVRKRLEEALMADMLAHVEELARDGEAPLDKACAEEEEEEEEEEEEPEPERV DIP protein Q9Z2D8 original sequence version: 99 E4E57BD48463643F evi1-mbd3 9 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association authors report they found and sequenced full-length isoform b (Mbd3b), however according to positions in fig 2 b, this corresponds to sp isoform 1. 1A evi1-mbd3-1 3 12 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait physical association physical association 1B and 1D mbd3-evi1 4 12 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. 10 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain [EBI-1994660] The range 191-429 was N-terminal and is not anymore. human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. association association 2A and C and 3B evi1-mbd3-2 4 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. 12 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. association association 2A Q9Z2D8-1, P14404 transfection evi1-mbd3-3 7 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. 14 unspecified role unspecified role prey prey association association 3D mbd3-evi1-1 6 10 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain [EBI-1994697] The range 191-315 was N-terminal and is not anymore. region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-phoenix Homo sapiens Phoenix cells phoenix Human Phoenix HEK 293T cells Phoenix cells are a derivative of 293 cells which have a very high efficiency of transfection (80-90%) by standard calcium phosphate methods. 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association 3C evi1-mbd3-4 2 10 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey association association 3E evi1-mbd3-5 1 10 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 5A mbd3-evi1-2 8 10 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component association association 5B Evi1 as well as Mbd3b appeared to be present in closely related high-molecular mass fractions of approximately 1−1.5 MDa (32) (Figure 5B). Appear to form high molecular weight complexes ~1.5mDa mbd3-evi1-3 5 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 16 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association 5C P14404 (HA-Evi1) transfection mbd3-mta2-1 5 16 unspecified role unspecified role bait bait region tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 13 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey association association 5C HA-Evi1 was not transfected.