IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. Oncogene (0950-9232) 2008 imex curation Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Accepted 2008-JUL-5 by DAVET. 25-Jun-2008: Contacted by JYOTI. Oncogene (0950-9232) 2008 davet Only protein-protein interactions imex curation CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. Oncogene (0950-9232) 2008 imex curation Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Accepted 2008-JUL-5 by DAVET. Oncogene (0950-9232) 2008 davet Only protein-protein interactions imex curation CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. Oncogene (0950-9232) 2008 imex curation Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Accepted 2008-JUL-5 by DAVET. 25-Jun-2008: Contacted by JYOTI. Oncogene (0950-9232) 2008 davet Only protein-protein interactions imex curation CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. Oncogene (0950-9232) 2008 imex curation Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Accepted 2008-JUL-5 by DAVET. 25-Jun-2008: Contacted by JYOTI. Oncogene (0950-9232) 2008 davet Only protein-protein interactions imex curation CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. CDK1 promotes cell proliferation and survival via phosphorylation and inhibition of FOXO1 transcription factor. Oncogene (0950-9232) 2008 imex curation Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu 25-Jun-2008: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Liu P., Kao TP., Huang H. Apoptosis - Interactions involving proteins with a function related to apoptosis The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. The Cell Signaling Technology website was consulted for information regarding the purified recombinant GST-cyclin B and GST-CDK1. huang253@umn.edu Accepted 2008-JUL-5 by DAVET. 25-Jun-2008: Contacted by JYOTI. Oncogene (0950-9232) 2008 davet Only protein-protein interactions imex curation ccnb1_human G2/mitotic-specific cyclin-B1 CCNB1 CCNB protein protein human Homo sapiens Human MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV DIP protein P14635 original sequence version: 146 DIP protein P14635 original sequence version: 108 DIP protein P14635 original sequence version: 145 DIP protein P14635 original sequence version: 139 E2C4767AE8A11EC0 bim_human_gene Human Bim gene gene gene human Homo sapiens Human cdk1_human Cyclin-dependent kinase 1 p34 protein kinase Cell division protein kinase 1 CDK1 CDC2 Cell division control protein 2 homolog CDC28A CDKN1 P34CDC2 protein protein human Homo sapiens Human MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM DIP protein P06493 original sequence version: 185 DIP protein P06493 original sequence version: 162 DIP protein P06493 original sequence version: 184 DIP protein P06493 original sequence version: 97 DIP protein P06493 original sequence version: 192 942D79448EFE490A foxo1_human Forkhead box protein O1 FOXO1 FKHR FOXO1A Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein human Homo sapiens Human MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPSASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHPAPPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPNYQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG DIP protein Q12778 original sequence version: 132 DIP protein Q12778 original sequence version: 84 6DEF6C994BDFDBAB cdc2-foxo1 2 9 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 8 enzyme enzyme unspecified role unspecified role human-lncap Human caucasian prostate carcinoma lncap Human caucasian prostate adenocarcinoma phosphorylation phosphorylation reaction phosphorylation 1 B CDK1 immunoprecipitated from LNCaP prostate cancer (PCa) cells phosphorylates the FO1-2 and FO1-3 GST-FOXO1 recombinant proteins. FOXO1 is phosphorylated cdc2-foxo1-1 2 6 unspecified role unspecified role ancillary ancillary n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 8 enzyme enzyme unspecified role unspecified role n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr Spodoptera frugiperda (Fall armyworm) Fall armyworm 9 enzyme target enzyme target substrate substrate unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q12778:p.Ser249Ala mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:10:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser249ala' Tue Jun 30 15:41:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser249Ala' phosphorylation phosphorylation reaction phosphorylation 1 C, E CDK1 immunoprecipitated from LNCaP prostate cancer (PCa) cells phosphorylates the FO1-2 and FO1-3 GST-FOXO1 recombinant proteins. FOXO1 is phosphorylated on Ser249 foxo1-cdc2 4 8 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 A V5-tagged CDK1 was detected in the protein complex immunoprecipitated by the anti-FLAG antibody. Reciprocally, FLAG-tagged FOXO1 was detected in the protein complex immunoprecipitated by the anti-V5 antibody Q12778; P06493 lysates cdc2-foxo1-2 4 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3 B Q12778; P06493 lysates V5-tagged CDK1 was detected in the protein complex immunoprecipitated by the anti-FLAG antibody. Reciprocally, FLAG-tagged FOXO1 was detected in the protein complex immunoprecipitated by the anti-V5 antibody cdc2-foxo1-3 3 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Notably, FOXO1 proteins were detected in the protein complex immunoprecipitated by the anti-CDK1 antibody 3 C foxo1-cdc2-1 5 8 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction 3 D Binding of 35S-labeled CDK1 proteins produced by in vitro transcription and translation to GST-FOXO1 recombinant proteins foxo1-bim 1 9 unspecified role unspecified role bait bait Q12778:p.[Thr24Ala;Ser256Ala;Ser319Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:13:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr24ala,ser256ala,ser319ala' Tue Jun 30 20:09:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr24Ala;Ser256Ala;Ser319Ala]' Q12778:p.[Thr24Ala;Ser249Ala;Ser256Ala;Ser319Ala] mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A certain certain sequence position certain certain certain sequence position certain S A Wed May 02 16:33:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr24ala,ser249ala,ser256ala,ser319ala' Tue Jun 30 18:16:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr24Ala;Ser249Ala;Ser256Ala;Ser319Ala]' 7 unspecified role unspecified role prey prey association association 6 D chromatin immunoprecipitation (ChIP) assays demonstrated that the binding of FOXO1-A3 but not FOXO1-A3/S249A to the promoter of the Bim gene was largely inhibited in cells transfected with CDK1-AF and cyclin B1 The binding of FOXO1-A3 (thr24ala/ser256ala/ser319ala) but not FOXO1-A3/ser249ala to the Bim promoter was largely inhibited in cells transfected with CDK1-AF and cyclin B1.