IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. PLoS ONE 2008 Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. davet chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy anti tag immunost anti tag immunostaining anti tag immunost Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es Accepted 2008-Not a month!-15 by DAVET. 03-Mar-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. PLoS ONE 2008 davet Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. PLoS ONE 2008 Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. davet chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down western blot western blot Immuno blot Immuno blot Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es Accepted 2008-Not a month!-15 by DAVET. 03-Mar-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. PLoS ONE 2008 davet Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. PLoS ONE 2008 Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. davet chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell extracts were fractionated on Superose 12 10/300 gl column. plazozbi@usal.es Accepted 2008-Not a month!-15 by DAVET. 03-Mar-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. PLoS ONE 2008 davet Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. PLoS ONE 2008 Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. davet chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 pull down pull down anti tag western anti tag western blot anti tag western Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es Accepted 2008-Not a month!-15 by DAVET. 03-Mar-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. PLoS ONE 2008 davet Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. PLoS ONE 2008 Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. davet human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es Accepted 2008-Not a month!-15 by DAVET. 03-Mar-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. PLoS ONE 2008 davet Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. PLoS ONE 2008 Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. davet in vitro In vitro pull down pull down autoradiography autoradiography Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es Accepted 2008-Not a month!-15 by DAVET. 03-Mar-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. PLoS ONE 2008 davet Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. Modulation of Interleukin-1 Transcriptional Response by the Interaction between VRK2 and the JIP1 Scaffold Protein. PLoS ONE 2008 Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es 03-Mar-2009: Contacted by JYOTI. 03-Feb-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. davet chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy immunostaining immunostaining Blanco S., Sanz-Garcia M., Santos CR., Lazo PA. Apoptosis - Interactions involving proteins with a function related to apoptosis plazozbi@usal.es Accepted 2008-Not a month!-15 by DAVET. 03-Mar-2009: Contacted by JYOTI. 23-04-2007: Lazo P., Instituto de Biologia Molecular y Celular del Cancer, Centro de Investigacion del Cancer, Salamanca, Spain The antibodies used for detecting the participants were anti-tag antibodies and polyclonal antibodies raised against specific proteins. PLoS ONE 2008 davet mk08_human Mitogen-activated protein kinase 8 MAPK8 JNK1 PRKM8 Stress-activated protein kinase JNK1 c-Jun N-terminal kinase 1 JNK-46 SAPK1 Stress-activated protein kinase 1c SAPK1C protein protein human Homo sapiens Human MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR DIP protein P45983 original sequence version: 96 DIP protein P45983 original sequence version: 185 DIP protein P45983 original sequence version: 124 DIP protein P45983 original sequence version: 103 94FB6BE0358B9B60 q86y07-2 Serine/threonine-protein kinase VRK2 VRK2 Vaccinia-related kinase 2 VRK2B protein protein human Homo sapiens Human MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQVEA No experimental confirmation available 0308378DD02D85EC q9wvi9-2 C-Jun-amino-terminal kinase-interacting protein 1 Mapk8ip1 Ib1 Jip1 Mapk8ip Prkm8ip Islet-brain-1 Mitogen-activated protein kinase 8-interacting protein 1 JNK MAP kinase scaffold protein 1 1 protein protein mouse Mus musculus Mouse MAERESGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGLLSAGSSGSAGSRLQAEMLQMDLIDAAGDTPGAEDDEEEEDDELAAQRPGVGPPKAESNQDPAPRSQGQGPGTGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQGSPVPTQDRGTSTDSPCRRSAATQMAPPSGPPATAPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDPAEPTSTFMPPTESRMSVSSDPDPAAYSVTAGRPHPSISEEDEGFDCLSSPERAEPPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASASSPYESAIGEEYEEAPQPRPPTCLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCVINGEEHEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSCVLEISVRGVKIGVKADDALEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE A303DB4A3C9A9775 jip1_cerae_protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to Q9UQF2 mp2k7_human Dual specificity mitogen-activated protein kinase kinase 7 MAPK/ERK kinase 7 JNK-activating kinase 2 c-Jun N-terminal kinase kinase 2 MAP2K7 JNKK2 MKK7 PRKMK7 MEK7 Stress-activated protein kinase kinase 4 SKK4 protein protein human Homo sapiens Human MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR F1B22E050F54299A vrk2b-cerae_protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to Q86Y07 vrk2a-cerae_protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt mk08-cerae_protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt Similar to P45983 vrk2_cerae_protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt q86y07-1 Serine/threonine-protein kinase VRK2 VRK2 Vaccinia-related kinase 2 VRK2A protein protein human Homo sapiens Human MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLIEKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKISYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLSEETNADVYYYRIIIPVLLMLVFLALFFL 9F3F6FCC9280568F calx_cerae protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey An amino acid sequence which is not represented in UniProt m3k7_human Mitogen-activated protein kinase kinase kinase 7 MAP3K7 TAK1 Transforming growth factor-beta-activated kinase 1 protein protein human Homo sapiens Human MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGNILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS DIP protein O43318 original sequence version: 145 DIP protein O43318 original sequence version: 138 DIP protein O43318 original sequence version: 131 3D8F8147CD174013 tab1_human TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 TAB1 MAP3K7IP1 TGF-beta-activated kinase 1-binding protein 1 Mitogen-activated protein kinase kinase kinase 7-interacting protein 1 protein protein human Homo sapiens Human MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYVANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTLLVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP DIP protein Q15750 original sequence version: 74 DIP protein Q15750 original sequence version: 110 DIP protein Q15750 original sequence version: 111 A45743288718983A calx_human Calnexin CANX Major histocompatibility complex class I antigen-binding protein p88 p90 IP90 protein protein human Homo sapiens Human MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE DIP protein P27824 original sequence version: 177 EDE094D9B82261EE jip1_mouse C-Jun-amino-terminal kinase-interacting protein 1 Mapk8ip1 Ib1 Jip1 Mapk8ip Prkm8ip Islet-brain-1 Mitogen-activated protein kinase 8-interacting protein 1 JNK MAP kinase scaffold protein 1 protein protein mouse Mus musculus Mouse MAERESGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGLLSAGSSGSAGSRLQAEMLQMDLIDAAGDTPGAEDDEEEEDDELAAQRPGVGPPKAESNQDPAPRSQGQGPGTGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQGSPVPTQDRGTSTDSPCRRSAATQMAPPSGPPATAPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDPAEPTSTFMPPTESRMSVSSDPDPAAYSVTAGRPHPSISEEDEGFDCLSSPERAEPPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASASSPYESAIGEEYEEAPQPRPPTCLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCVINGEEHEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWIDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDALEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE 274013B12D91049D jip1_human C-Jun-amino-terminal kinase-interacting protein 1 MAPK8IP1 IB1 JIP1 PRKM8IP JNK MAP kinase scaffold protein 1 Islet-brain 1 Mitogen-activated protein kinase 8-interacting protein 1 protein protein human Homo sapiens Human MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISLQCKDTLSLRPPRAGLLSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAARRPGAGPPKAESGQEPASRGQGQSQGQSQGPGSGDTYRPKRPTTLNLFPQVPRSQDTLNNNSLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQSGPAPTTDRGTSTDSPCRRSTATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFLPPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGGGWRGSLGEPPPPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVSSPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLFSCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFPAYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLTVHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFITKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE 55EA53B30080A751 vrk2-jip1 2 11 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4I JIP1 protein was also brought down by GST-VRK2A (Fig. 4I). These data supports the specificity of the interaction between VRK2A and JIP1. jip1-calnexin 5 23 unspecified role unspecified role neutral component neutral component 21 unspecified role unspecified role neutral component neutral component colocalization colocalization 5A JIP1 signal colocalized, in both cell lines, indicating close proximity with both ER jip1-clnx 7 11 unspecified role unspecified role neutral component neutral component 18 unspecified role unspecified role neutral component neutral component colocalization colocalization 5A JIP1 signal colocalized, in both cell lines, indicating close proximity with both ER vrk2a-jip1 1 11 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 5C endogenous JIP1 proteinm overlapped in part with the VRK2A signal that has been reported to be bound to the endoplasmic reticulum by its C-terminal region (Fig. 5C, left column). In the case of VRK2B the pattern detected is much more diffuse in the cytosol (Fig. 5C, right column) vrk2-jip1-1 2 16 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4H The endogenous VRK2 protein was brought down in a pull-down assay with GST-JIP1 (Fig. 4H). jip1-vrk2a 4 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A,B,C,D,E Both, VRK2A and VRK2B, were able to form a stable complex with JIP1 vrk2-jip1-2 6 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction 4G VRK2A was in vitro translated and used for a pull-down-assay using different GSTJIP1 protein constructs expressed in bacteria. VRK2A was able to interact with the C-terminal region of JIP1 (Fig. 4G) jip1-vrk2b-1 4 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A,B,C,D,E Both, VRK2A and VRK2B, were able to form a stable complex with JIP1 vrk2b-jip1-1 1 11 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization 5C endogenous JIP1 proteinm overlapped in part with the VRK2A signal that has been reported to be bound to the endoplasmic reticulum by its C-terminal region (Fig. 5C, left column). In the case of VRK2B the pattern detected is much more diffuse in the cytosol (Fig. 5C, right column) jip1-jnk 3 8 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 8C Oligomeric complex of molecular weight of about 1200 kDa. Cos1 cells were transfected with the proteins. The cell extracts were fractionated and complexes at high molecular weigh containing the proteins JIP1, TAK1, TAB1, MKK7 and JNK were detected, suggesting that when the phosphorylation cascade is activated jip1-vrk2a-1 3 17 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 8D Cos1 cells were transfected with the proteins. The cell extracts were fractionated and complexes at high molecular weigh containing the proteins JIP1, TAK1, TAB1, MKK7 and JNK were detected, suggesting that when the phosphorylation cascade is activated jip1-vrk2b 3 9 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 8E Cos1 cells were transfected with the proteins. The cell extracts were fractionated and complexes at high molecular weigh containing the proteins JIP1, TAK1, TAB1, MKK7 and JNK were detected, suggesting that when the phosphorylation cascade is activated More JNK was free in the presence of VRK2B and the complex formed seemed to be less stable. jip1-2 3 23 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 8B Oligomeric complex of molecular weight of about 300 to 1200 kDa. Cos1 cells were transfected with the proteins. Surprisingly JIP1, endogenous or transfected were forming large complexes in the range 300 to 1200 kDa The stoichiometry of the compelx cannot be accurately depicted. jip1-vrk2a-2 3 14 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component association association 8a In the case of endogenous JIP1 also smaller complexes were detected, but they contain bound endogenous VRK2A, which is not detected free (Fig. 8A). The higher molecular weight complexes of about 1200 kDa are observed with VRK2A. jip1-vrk2a-3 3 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 15 unspecified role unspecified role neutral component neutral component association association 8a In the case of endogenous JIP1 also smaller complexes were detected, but they contain bound endogenous VRK2A, which is not detected free (Fig. 8A). tak1-vrk2a 2 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6A In the absence of JIP1, TAK1 (Fig. 6A) [51], and MKK7 (Fig. 6B), but not JNK (Fig. 6C), were able to stably interact with VRK2A Cotransfection with FLAG-TAB1 transfection vrk2a-mkk7-1 2 17 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6B In the absence of JIP1, TAK1 (Fig. 6A) [51], and MKK7 (Fig. 6B), but not JNK (Fig. 6C), were able to stably interact with VRK2A transfection tak1-vrk2a-1 2 23 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6A Since this cells expresses JIP1 is also possible that the interaction of TAK1 or MKK7 and VRK2A was mediated by endogenous JIP1 Cotransfection with FLAG-TAB1 transfection tak1-vrk2b 2 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6A Cotransfection with FLAG-TAB1 transfection vrk2a-mkk7-2 2 23 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6B Since this cells expresses JIP1 is also possible that the interaction of TAK1 or MKK7 and VRK2A was mediated by endogenous JIP1 transfection vrk2b-mkk7 2 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6B Since this cells expresses JIP1 is also possible that the interaction of TAK1 or MKK7 and VRK2A was mediated by endogenous JIP1 transfection vrk2a-jnk 2 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C In the absence of JIP1, TAK1 (Fig. 6A) [51], and MKK7 (Fig. 6B), but not JNK (Fig. 6C), were able to stably interact with VRK2A transfection vrk2b-jnk 2 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role prey prey region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 6C transfection tak1-vrk2b-1 2 23 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Cotransfection with FLAG-TAB1 transfection jip1-vrk2b-2 2 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey Q86Y07-2:p.Lys168Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 18:52:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys168glu' Tue Jun 30 15:56:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys168Glu' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7A jip1-vrk2b-3 2 9 unspecified role unspecified role prey prey Q86Y07-2:p.Lys168Glu mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K E Wed May 02 14:38:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys168glu' Tue Jun 30 17:30:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys168Glu' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7B TAB1 was cotransfected in the COS cells. jip1-vrk2b-4 2 9 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7C TAB1 was cotransfected in the COS cells. jip1-vrk2a-4 2 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7A jip1-vrk2a-5 2 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7B TAB1 was cotransfected in the COS cells. jip1-vrk2a-6 2 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 7B TAB1 was cotransfected in the COS cells. jnk-jip1 2 19 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 23 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 10 TAB1 was cotransfected in the COS cells. As the VRK2 was increased in amount the phosphorylated JNK associated witht he complex decreased. This was true for the kinase dead form of VRK2 as well. In the pulled-down proteins, as VRK2A protein (or its kinase-dead variant) increased, the level of phosphorylated JNK clearly decreased, a difference that was not detectable in the whole cell lysate, and thus is likely to represent a subpopulation of JNK bound to JIP1.