IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ BLOC1S2 interacts with the HIPPI protein and sensitizes NCH89 glioblastoma cells to apoptosis. BLOC1S2 interacts with the HIPPI protein and sensitizes NCH89 glioblastoma cells to apoptosis. Apoptosis (1360-8185) 2008 imex curation Gdynia G., Lehmann-Koch J., Sieber S., Tagscherer KE., Fassl A., Zentgraf H., Matsuzawa SI., Reed JC., Roth W. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer W.Roth@dkfz.de A human fetal brain cDNA library was used. davet Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Gdynia G., Lehmann-Koch J., Sieber S., Tagscherer KE., Fassl A., Zentgraf H., Matsuzawa SI., Reed JC., Roth W. Apoptosis - Interactions involving proteins with a function related to apoptosis W.Roth@dkfz.de Accepted 2008-FEB-23 by DAVET. A human fetal brain cDNA library was used. Apoptosis (1360-8185) 2008 davet Only protein-protein interactions imex curation BLOC1S2 interacts with the HIPPI protein and sensitizes NCH89 glioblastoma cells to apoptosis. BLOC1S2 interacts with the HIPPI protein and sensitizes NCH89 glioblastoma cells to apoptosis. Apoptosis (1360-8185) 2008 imex curation Gdynia G., Lehmann-Koch J., Sieber S., Tagscherer KE., Fassl A., Zentgraf H., Matsuzawa SI., Reed JC., Roth W. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer W.Roth@dkfz.de A human fetal brain cDNA library was used. davet Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gdynia G., Lehmann-Koch J., Sieber S., Tagscherer KE., Fassl A., Zentgraf H., Matsuzawa SI., Reed JC., Roth W. Apoptosis - Interactions involving proteins with a function related to apoptosis W.Roth@dkfz.de Accepted 2008-FEB-23 by DAVET. A human fetal brain cDNA library was used. Apoptosis (1360-8185) 2008 davet Only protein-protein interactions imex curation bl1s2_human Biogenesis of lysosome-related organelles complex 1 subunit 2 BLOC1S2 BLOS2 CEAP Centrosome-associated protein protein protein human Homo sapiens Human MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR 023DDBAC66E1912B ift57_human Intraflagellar transport protein 57 homolog IFT57 DERP8 ESRRBL1 HIPPI HIP1-interacting protein Estrogen-related receptor beta-like protein 1 Dermal papilla-derived protein 8 MHS4R2 protein protein human Homo sapiens Human MTAALAVVTTSGLEDGVPRSRGEGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILSELRSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAEDDAELTLNKVDEEFVEEETDNEENFIDLNVLKAQTYHLDMNETAKQEDILESTTDAAEWSLEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALKETKGFLDKLHNEITRTLEKISSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVMEELEKVKQEMEEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSNMTRNMHATVIPEPATGFY D80200D957AE5AC4 ift57-bloc1s2 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal pDED domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association To identify proteins that associate with the human HIPPI protein, we performed a yeast two hybrid cDNA library screen with HIPPI as a bait. We identified a protein of 99 amino acids in length that was identical to the protein BLOC1S2 bloc1s2-ift57 1 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 A we performed co-immunoprecipitation (co-IP) experiments, wherein BLOC1S2 and HIPPI were expressed in HEK293T cells with various epitope tags. In accordance with the yeast two-hybrid assays, these studies indicated that BLOC1S2 binds to HIPPI Q6QNY1; Q9NWB7 transfection bloc1s2-ift57-1 1 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined c-terminal pDED domain sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2 B the pDED of HIPPI retained the capacity to bind BLOC1S2 Q6QNY1; Q9NWB7 transfection