MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. EMBO J. (0261-4189) 2007 imex curation Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com Accepted 2011-NOV-09 by ORCHARD EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. EMBO J. (0261-4189) 2007 imex curation Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com Accepted 2011-NOV-09 by ORCHARD 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. EMBO J. (0261-4189) 2007 imex curation Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-mv4-11 Human MV4-11, Acute Monocytic Leukemia cell line mv4-11 MV4-11 a human MLL leukemia cell line https://www.lgcstandards-atcc.org/Products/All/CRL-9591.aspx Human acute monocytic leukemia cell line. Described to carry a 4;11 translocation; MV4-11 carries an FLT3 internal tandem duplication. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com Accepted 2011-NOV-09 by ORCHARD 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. EMBO J. (0261-4189) 2007 imex curation Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com Accepted 2011-NOV-09 by ORCHARD 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. Functional and physical interaction between Bcl-X(L) and a BH3-like domain in Beclin-1. EMBO J. (0261-4189) 2007 imex curation Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Maiuri M.C., Le Toumelin G., Criollo A., Rain J.C., Gautier F., Juin P., Tasdemir E., Pierron G., Troulinaki K., Tavernarakis N., Hickman J.A., Geneste O., Kroemer G. Apoptosis - Interactions involving proteins with a function related to apoptosis Interactions concerning Bcl2 and Mcl1 constructs (figures 2d and 2e), as well as those involving BAK peptides (supplementary figure 1)are not included due to lack of reference fo their origin in the text. Interactions depicted in figures 7a and 7b were not included due to lack of information about the cell line used in the experiment. olivier.geneste@fr.netgrs.com Accepted 2011-NOV-09 by ORCHARD 21-Dec-2011: Contacted by JYOTI. EMBO J. (0261-4189) 2007 Only protein-protein interactions imex curation becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ DIP protein Q92934 original sequence version: 66 DIP protein Q92934 original sequence version: 121 69FD8D27DDEE3241 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB bcl2l1-becn1 1 9 unspecified role unspecified role bait bait bcl-xl delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey binding region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 15 13 physical association physical association 1a bcl2-becn1 1 6 unspecified role unspecified role prey prey binding region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait bcl2 delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 20 physical association physical association 1a bcl2l1-bak1 5 6 competitor competitor competitor neutral component neutral component purified purified Q14457:p.Leu116Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:21:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu116ala' Tue Jun 30 17:38:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu116Ala' Q14457:p.Phe123Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:09:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe123ala' Tue Jun 30 18:02:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe123Ala' bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role neutral component neutral component purified purified fluorescein tag fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified bcl-xl delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 1c bak1-bcl2l1-3 5 8 competitor competitor competitor neutral component neutral component purified purified bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified bcl-xl delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component purified purified fluorescein tag fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 1c bak1-bcl2l1-4 5 6 competitor competitor competitor neutral component neutral component purified purified fluorescein tag fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bh3 domain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range bcl-xl delta-tm sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q07817-1:p.Gly138Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 19:43:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly138ala' Tue Jun 30 16:25:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly138Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction 1d and 2a BH3 domain mimetic compound ABT737 disrupts the interaction in a dose-dependent manner. bcl2l1-becn1-1 4 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey Q14457:p.Phe123Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 19:36:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe123ala' Tue Jun 30 19:55:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe123Ala' v5-his tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14457:p.Leu116Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:07:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu116ala' Tue Jun 30 19:08:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu116Ala' physical association physical association 1e and 2b BH3 domain mimetic compound ABT737 disrupts the interaction in a dose-dependent manner. bcl2l1-becn1-2 4 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q07817-1:p.Gly138Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 18:47:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly138ala' Tue Jun 30 19:19:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly138Ala' 6 unspecified role unspecified role prey prey physical association physical association 1f and 2c BH3 domain mimetic compound ABT737 disrupts the interaction in a dose-dependent manner. bcl2-becn1-1 2 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 6a, 7G BH3 domain mimetic compound ABT737 and starvation conditions disrupt the interaction. bcl2-becn1-2 3 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association 6a BH3 domain mimetic compound ABT737 and starvation conditions disrupt the interaction. bcl2-bad-2 2 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association 7c BH3 domain mimetic compound ABT737 and starvation conditions disrupt the interaction.