IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Science (0036-8075) 2007 imex curation Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Accepted 2012-JUL-12 by JYOTI Science (0036-8075) 2007 Only protein-protein interactions imex curation Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Science (0036-8075) 2007 imex curation Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Accepted 2012-JUL-12 by JYOTI Science (0036-8075) 2007 Only protein-protein interactions imex curation Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Science (0036-8075) 2007 imex curation Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Accepted 2012-JUL-12 by JYOTI Science (0036-8075) 2007 Only protein-protein interactions imex curation Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak. Science (0036-8075) 2007 imex curation Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Only protein-protein interactions mouse-thymus Mus musculus thymus thymus anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Willis S.N., Fletcher J.I., Kaufmann T., van Delft M.F., Chen L., Czabotar P.E., Ierino H., Lee E.F., Fairlie W.D., Bouillet P., Strasser A., Kluck R.M., Adams J.M., Huang D.C. Apoptosis - Interactions involving proteins with a function related to apoptosis huang_d@wehi.edu.au Accepted 2012-JUL-12 by JYOTI Science (0036-8075) 2007 Only protein-protein interactions imex curation bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ DIP protein Q61337 original sequence version: 60 6C2BA910205053F7 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E bbc3_human Bcl-2-binding component 3, isoforms 1/2 p53 up-regulated modulator of apoptosis JFY-1 BBC3 PUMA protein protein human Homo sapiens Human MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN DIP protein Q9BXH1 original sequence version: 32 3585527F1858A4FA q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK DIP protein Q92843 original sequence version: 103 DIP protein Q92843 original sequence version: 85 DIP protein Q92843 original sequence version: 112 3542243A532B1762 o43521-2 Bcl-2-like protein 11 Bim(L) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH 8BB4AAE06CB080FA b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 bcl2_mouse Apoptosis regulator Bcl-2 Bcl2 Bcl-2 protein protein mouse Mus musculus Mouse MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10417 original sequence version: 71 DIP protein P10417 original sequence version: 126 80FDCFE78C735092 o43521-4 Bcl-2-like protein 11 BimABCD Bim-ABCD BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK E2E24D5697C955BA o43521-6 Bcl-2-like protein 11 BCL2-like 11 transcript variant 10 BCL2L11 BIM Bcl2-interacting mediator of cell death Bim-AD BimAD protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK 3E03CCF2154A242C b2la1_mouse Bcl-2-related protein A1 Protein BFL-1 Hemopoietic-specific early response protein A1-A Bcl2a1 A1 Bcl2a1a Bfl1 protein protein mouse Mus musculus Mouse MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK DIP protein Q07440 original sequence version: 62 37AD35818E756488 mcl1_mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Bcl-2-related protein EAT/mcl1 Mcl1 protein protein mouse Mus musculus Mouse MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein P97287 original sequence version: 123 E4FD369DB0EC6723 bik_human Bcl-2-interacting killer Apoptosis inducer NBK BP4 BIP1 BIK NBK protein protein human Homo sapiens Human MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK DIP protein Q13323 original sequence version: 131 DIP protein Q13323 original sequence version: 119 89034F4443F5A136 o43521-3 Bcl-2-like protein 11 Bim(S) BCL2-like 11 transcript variant 9 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH 60067208524D5BEA bmf_human Bcl-2-modifying factor BMF protein protein human Homo sapiens Human MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR 21479B25CC727853 bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF o43521-1 Bcl-2-like protein 11 Bim(EL) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH D75735E469CA6997 b2l11_mouse Bcl-2-like protein 11 Bcl2-interacting mediator of cell death Bcl2l11 Bim protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH DIP protein O54918 original sequence version: 130 531C176E5F1AC9AA bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 o43521-5 Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death Bim-ACD BimACD protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK 4335FA21C13B49AD bcl2l11-bax 3 12 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. direct interaction direct interaction S1a This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid-bax-1 3 21 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. direct interaction direct interaction S1a This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-bcl2 3 9 competitor competitor competitor prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 12 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-bclxl 3 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 12 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 competitor competitor competitor prey prey purified purified gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-mcl1 3 12 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 17 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. ecoli Escherichia coli (strain K12) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-a1 3 12 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 16 competitor competitor competitor prey prey purified purified gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bim-bclw 3 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 12 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 10 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q92843:p.[Cys29Ser;Ala128Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain A L Wed May 02 19:33:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys29ser,ala128leu' Tue Jun 30 17:18:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys29Ser;Ala128Leu]' This mutation stabilizes this protein and allows its purification when expressed in E. coli. ecoli Escherichia coli (strain K12) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-bcl2 3 21 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 9 competitor competitor competitor prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-bclxl 3 8 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 21 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-bcl2 3 9 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 21 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-bclxl 3 21 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 8 competitor competitor competitor prey prey purified purified gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-bclw 3 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 21 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 10 competitor competitor competitor prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q92843:p.[Cys29Ser;Ala128Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain A L Wed May 02 14:30:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys29ser,ala128leu' Tue Jun 30 16:58:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys29Ser;Ala128Leu]' This mutation stabilizes this protein and allows its purification when expressed in E. coli. ecoli Escherichia coli (strain K12) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-bclw 3 21 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 10 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q92843:p.[Cys29Ser;Ala128Leu] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain A L Wed May 02 16:53:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys29ser,ala128leu' Tue Jun 30 19:15:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys29Ser;Ala128Leu]' This mutation stabilizes this protein and allows its purification when expressed in E. coli. ecoli Escherichia coli (strain K12) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-mcl1 3 21 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 17 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-mcl1 3 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 21 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 17 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. ecoli Escherichia coli (strain K12) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid34-a1 3 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 16 competitor competitor competitor prey prey purified purified gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid24-a1 3 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 16 competitor competitor competitor prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gplgs residual tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Residual tag reulting from the cleavage of a GST tag used during the purification of this protein. ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role bait bait purified purified bid 24 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association S1c This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bid-bax-2 3 21 competitor competitor competitor prey prey purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 21 unspecified role unspecified role bait bait purified purified bid 34 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. physical association physical association 1b This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. IC50 ranges from 2 to 10 microM. bcl2l11-bax-2 3 12 competitor competitor competitor prey prey purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 24 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) This is a denatured form of Bax, treated with octyl-glucoside in order to expose its hydrophobic residues and allow the interaction. 12 unspecified role unspecified role bait bait purified purified bim 26 mer peptide sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 1b This interaction happens with a de-natured from of Bax. The natively folded form of Bax did not show interaction in this experimental conditions. bax-bak1 1 9 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S4a, S4b and S4c Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bcl2 to happen. Very low interaction with Bcl2 coudl be detected upon treatment with CHAPS. The rest of the preys interacted independently of this treatment. bid-bax-3 1 24 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined tbid region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain association association S4a Treatment with T-X100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bid-bax-4 1 9 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait tbid region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4a bax-bak1-1 1 24 unspecified role unspecified role prey prey 24 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey association association S4a, S4b and S4c bcl2l11-bcl2-4 1 9 unspecified role unspecified role prey prey 22 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4b bcl2l11-bcl2-5 1 9 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4b bcl2l11-bax-3 1 19 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey association association S4b Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bik-bcl2-2 1 18 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association S4c bmf-bcl2 1 9 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4c bad-bcl2 1 5 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association S4c bbc3-bcl2 1 7 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association S4c bcl2l11-bcl2-7 4 13 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 23 unspecified role unspecified role bait bait association association 1c Treatment with ionomycin (induces cell death through Bim) increases the interaction. bid-bcl2-1 1 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 21 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P55957:p.Gly94Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 15:25:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly94ala' Tue Jun 30 20:26:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly94Ala' This mutation disrupts the co-inmunoprecipitation of Bax in this complex. P55957:p.Gly94Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:41:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly94ala' Tue Jun 30 18:21:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly94Ala' This mutation decreases the co-inmunoprecipitation of Bcl2, Bcl-Xl and Mcl-1 in this complex. tbid region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P55957:p.Gly94Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Wed May 02 18:51:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly94glu' Tue Jun 30 18:42:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly94Glu' association association 2a Lysates were treated with TX100 to allow the interaction of Bax. bims-bcl2-1 1 19 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O43521-3:p.Gly66Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:06:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly66ala' Tue Jun 30 15:41:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly66Ala' This mutation disrupts the co-inmunoprecipitation of Bax in this protein complex. O43521-3:p.Gly66Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G E Wed May 02 17:25:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly66glu' Tue Jun 30 17:01:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly66Glu' This mutation disrupts the co-inmunoprecipitation of Bax, Bcl2, BclXL and BclW in this protein complex. 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey association association S8a Lysates were treated with TX100 to allow the interaction of Bax. bax-bcl2-1 2 24 unspecified role unspecified role bait bait Q07812:p.Lys64Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 15:35:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys64ala' Tue Jun 30 18:00:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys64Ala' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S15a and S15b Lysates were treated with TX100 to allow the interaction of Bax. bcl2-bax-5 2 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role prey prey Q07812:p.Lys64Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:05:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys64ala' Tue Jun 30 19:59:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys64Ala' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S15a and S15b Lysates were treated with TX100 to allow the interaction of Bax. bax-bcxl 2 8 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S15a and S15b Lysates were treated with TX100 to allow the interaction of Bax. bcl2l1-bax-2 2 8 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S15a and S15b Lysates were treated with TX100 to allow the interaction of Bax. bcl2l2-bax-3 2 24 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S15a and S15b Lysates were treated with TX100 to allow the interaction of Bax. bax-bcl2l2-1 2 10 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 24 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S15a and S15b Lysates were treated with TX100 to allow the interaction of Bax. bax-mcl1 2 24 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role prey prey flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S15a and S15b Lysates were treated with TX100 to allow the interaction of Bax. mcl1-bax 2 24 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S15a and S15b Lysates were treated with TX100 to allow the interaction of Bax. bcl2l11-bax-4 1 24 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association S4b Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bcl2l11-bax-5 1 25 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey association association S4b Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen. bcl2l11-bax-6 1 15 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 24 unspecified role unspecified role prey prey association association S4b Treatment with Triton X-100 (exposes hydrophobic residues in Bax) is required for the interaction with Bax to happen.