IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. Breast Cancer Res. (1465-5411) 2007 Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer yusuke@ims.u-tokyo.ac.jp davet in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis yusuke@ims.u-tokyo.ac.jp Accepted 2007-SEP-28 by DAVET. Breast Cancer Res. (1465-5411) 2007 davet Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. Breast Cancer Res. (1465-5411) 2007 Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer yusuke@ims.u-tokyo.ac.jp davet human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis yusuke@ims.u-tokyo.ac.jp Accepted 2007-SEP-28 by DAVET. Breast Cancer Res. (1465-5411) 2007 davet Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. Involvement of maternal embryonic leucine zipper kinase (MELK) in mammary carcinogenesis through interaction with Bcl-G, a pro-apoptotic member of the Bcl-2 family. Breast Cancer Res. (1465-5411) 2007 Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer yusuke@ims.u-tokyo.ac.jp davet in vitro In vitro pull down pull down ms participant Identification by mass spectrometry ms participant Lin ML., Park JH., Nishidate T., Nakamura Y., Katagiri T. Apoptosis - Interactions involving proteins with a function related to apoptosis yusuke@ims.u-tokyo.ac.jp Accepted 2007-SEP-28 by DAVET. Breast Cancer Res. (1465-5411) 2007 davet b2l14_human Apoptosis facilitator Bcl-2-like protein 14 Apoptosis regulator Bcl-G BCL2L14 BCLG protein protein human Homo sapiens Human MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD 155D43BA91BFB3EA melk_human Maternal embryonic leucine zipper kinase Protein kinase PK38 MELK KIAA0175 Protein kinase Eg3 Tyrosine-protein kinase MELK protein protein human Homo sapiens Human MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV 57F05CDC6122E570 melk-bcl2l14 3 4 unspecified role unspecified role prey prey human-hbc4 Homo sapiens breast cancer cell line HBC4 hbc4 Human breast cancer cell line HBC4 5 unspecified role unspecified role bait bait Q14680:p.Asp150Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:39:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp150ala' Tue Jun 30 16:33:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp150Ala' ecobb Escherichia coli (strain B / BL21) physical association physical association 3 A Comparison of silver staining of SDS-PAGE gels containing the pulled-down proteins identified an approximately 30 kDa protein in the lane corresponding to proteins pulled-down with WT-MELK but not in that corresponding to proteins pulled-down with D150A-MELK (Figure 3a). MALDITOF analysis showed this 30 kDa protein to be Bcl-G, a member of the Bcl-2 protein family BAIT gene NM_014791 melk-bcl2l14-1 2 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association Immunoblotting of the precipitates using anti-HA antibodies indicated that Flag-Bcl-GL was co-precipitated with HA-WT-MELK 3 C, E, F Q14680; Q9BZR8 transfection melk-bcl2l14-2 3 4 unspecified role unspecified role prey prey ecobb Escherichia coli (strain B / BL21) 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14680:p.Asp150Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:44:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp150ala' Tue Jun 30 18:01:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp150Ala' ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction we demonstrated that His-tagged WTMELK could pull-down with Bcl-GL but His-tagged D150AMELK could not, indicating that, in vitro, Bcl-GL interacts directly with WT-MELK but not with D150A-MELK 3 D melk-bcl2l14-3 1 5 enzyme enzyme bait bait Q14680:p.Asp150Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:09:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp150ala' Tue Jun 30 18:38:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp150Ala' 4 enzyme target enzyme target substrate substrate prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain phosphorylation phosphorylation reaction phosphorylation we also confirmed that WT-MELK could phosphorylate GST-Bcl-GL but D150A-MELK could not 4 B, C