IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Caspase-8 prevents sustained activation of NF-kappaB in monocytes undergoing macrophagic differentiation. Caspase-8 prevents sustained activation of NF-kappaB in monocytes undergoing macrophagic differentiation. Blood (0006-4971) 2007 imex curation Rebe C., Cathelin S., Launay S., Filomenko R., Prevotat L., L'Ollivier C., Gyan E., Micheau O., Grant S., Dubart-Kupperschmitt A., Fontenay M., Solary E. Apoptosis - Interactions involving proteins with a function related to apoptosis The cells used in this experiment were differenciated to macrophages by TPA treatment. esolary@u-bourgogne.fr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-macrophage Human macrophages macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rebe C., Cathelin S., Launay S., Filomenko R., Prevotat L., L'Ollivier C., Gyan E., Micheau O., Grant S., Dubart-Kupperschmitt A., Fontenay M., Solary E. Apoptosis - Interactions involving proteins with a function related to apoptosis The cells used in this experiment were differenciated to macrophages by TPA treatment. esolary@u-bourgogne.fr Accepted 2011-NOV-01 by MGT Blood (0006-4971) 2007 Only protein-protein interactions imex curation Caspase-8 prevents sustained activation of NF-kappaB in monocytes undergoing macrophagic differentiation. Caspase-8 prevents sustained activation of NF-kappaB in monocytes undergoing macrophagic differentiation. Blood (0006-4971) 2007 imex curation Rebe C., Cathelin S., Launay S., Filomenko R., Prevotat L., L'Ollivier C., Gyan E., Micheau O., Grant S., Dubart-Kupperschmitt A., Fontenay M., Solary E. Apoptosis - Interactions involving proteins with a function related to apoptosis The cells used in this experiment were differenciated to macrophages by TPA treatment. esolary@u-bourgogne.fr 21-Dec-2011: Contacted by JYOTI. Only protein-protein interactions human-u937 Homo sapiens histiocytic lymphoma cells u937 Human histiocytic lymphoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Rebe C., Cathelin S., Launay S., Filomenko R., Prevotat L., L'Ollivier C., Gyan E., Micheau O., Grant S., Dubart-Kupperschmitt A., Fontenay M., Solary E. Apoptosis - Interactions involving proteins with a function related to apoptosis The cells used in this experiment were differenciated to macrophages by TPA treatment. esolary@u-bourgogne.fr Accepted 2011-NOV-01 by MGT 21-Dec-2011: Contacted by JYOTI. Blood (0006-4971) 2007 Only protein-protein interactions imex curation casp8_human Caspase-8 CASP8 MCH5 ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog FADD-homologous ICE/ced-3-like protease FADD-like ICE Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 protein protein human Homo sapiens Human MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD DIP protein Q14790 original sequence version: 184 DIP protein Q14790 original sequence version: 135 DIP protein Q14790 original sequence version: 136 DIP protein Q14790 original sequence version: 147 DIP protein Q14790 original sequence version: 146 DIP protein Q14790 original sequence version: 170 DIP protein Q14790 original sequence version: 198 DIP protein Q14790-1 original sequence version: 197 DIP protein Q14790 original sequence version: 158 7A5FEAA6B39B582F ripk1_human Receptor-interacting serine/threonine-protein kinase 1 RIPK1 RIP Cell death protein RIP RIP1 Receptor-interacting protein 1 protein protein human Homo sapiens Human MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEALLEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIILEIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVDGTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMCIKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEEDVKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN DIP protein Q13546 original sequence version: 158 DIP protein Q13546-1 original sequence version: 140 DIP protein Q13546 original sequence version: 146 DIP protein Q13546-1 original sequence version: 146 DIP protein Q13546 original sequence version: 134 DIP protein Q13546 original sequence version: 109 976E2428D525A9B2 tnr6_human Tumor necrosis factor receptor superfamily member 6 FASLG receptor Apoptosis-mediating surface antigen FAS Apo-1 antigen FAS APT1 TNFRSF6 FAS1 protein protein human Homo sapiens Human MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV 0139942535111410 cflar_human CASP8 and FADD-like apoptosis regulator Cellular FLICE-like inhibitory protein Caspase-eight-related protein Caspase-like apoptosis regulatory protein MACH-related inducer of toxicity Caspase homolog Inhibitor of FLICE FADD-like antiapoptotic molecule 1 Usurpin CFLAR CASH CLARP MRIT CASP8AP1 protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT 8C6D7E92AE1EB672 o15519-1 CASP8 and FADD-like apoptosis regulator FLIP-L CLARP1 MRIT alpha-1 CASH alpha I-FLICE 1 FLAME-1 gamma Usurpin alpha CFLAR CASH CASP8AP1 CLARP MRIT Caspase homolog Caspase-eight-related protein Caspase-like apoptosis regulatory protein Cellular FLICE-like inhibitory protein FADD-like antiapoptotic molecule 1 Inhibitor of FLICE MACH-related inducer of toxicity Usurpin protein protein human Homo sapiens Human MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT DIP protein O15519-1 original sequence version: 143 8C6D7E92AE1EB672 tr10b_human Tumor necrosis factor receptor superfamily member 10B Death receptor 5 TNF-related apoptosis-inducing ligand receptor 2 UNQ160/PRO186 TNFRSF10B DR5 KILLER TRAILR2 TRICK2 ZTNFR9 protein protein human Homo sapiens Human MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKVLPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGVNMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRKLGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIEDHLLSSGKFMYLEGNADSAMS 60358EAF2A835870 fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 traf2_human TNF receptor-associated factor 2 TRAF2 TRAP3 Tumor necrosis factor type 2 receptor-associated protein 3 E3 ubiquitin-protein ligase TRAF2 RING-type E3 ubiquitin transferase TRAF2 protein protein human Homo sapiens Human MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL DIP protein Q12933 original sequence version: 131 DIP protein Q12933 original sequence version: 129 DIP protein Q12933 original sequence version: 167 DIP protein Q12933 original sequence version: 193 DIP protein Q12933-1 original sequence version: 154 DIP protein Q12933 original sequence version: 130 DIP protein Q12933 original sequence version: 151 C508BE185B783B20 tr10a_human Tumor necrosis factor receptor superfamily member 10A Death receptor 4 TNF-related apoptosis-inducing ligand receptor 1 TNFRSF10A APO2 DR4 TRAILR1 protein protein human Homo sapiens Human MAPPPARVHLGAFLAVTPNPGSAASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARAGRAPGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHNIWVILVVTLVVPLLLVAVLIVCCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAREKIQDLLVDSGKFIYLEDGTGSAVSLE 7E96619D0BDC0CD4 tradd_human Tumor necrosis factor receptor type 1-associated DEATH domain protein TRADD TNFRSF1A-associated via death domain protein protein human Homo sapiens Human MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA DIP protein Q15628 original sequence version: 92 DIP protein Q15628 original sequence version: 132 DIP protein Q15628 original sequence version: 156 DIP protein Q15628 original sequence version: 77 5645D7E63E5FF05A casp8-cflar 1 3 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey association association 2a This interaction was also tested in monocytes and dendritic cells, with negative results, according to the authors. While the negative result is quite clear in the case of monocytes, there are very faint bands visible in the case of FADD and RIPK1 in dendritic cells, so this negative interaction was not recorded. casp8-cflar-14 2 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait Processed (active) forms appear after TPA treatment. 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey Cleaved forms of ripk1 were detected in late time points (12 and 24 hours) after TPA treatment. association association 2b, 3a, 3b and 3c TPA treatment (differentiation into macrophages) was required for the interaction to happen. Isoforms L of cflar, according to authors is the one detected in this interaction (fig 2a). Other isoforms, most prominently S, can be detected in further experiments (figs. 3a-c). cflar-casp8 2 3 unspecified role unspecified role prey prey Processed (active) forms appear after TPA treatment. 6 unspecified role unspecified role bait bait cflar-L (O15519-1), -S (O15519-2) and cleaved forms were detected after TPA treatment. 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey Processed forms were detected after TPA treatment. association association 2b TPA treatment (differentiation into macrophages) was required for the interaction to happen. casp8-cflar-13 2 3 unspecified role unspecified role bait bait Processed (active) forms appear after TPA treatment. 4 unspecified role unspecified role prey prey A processed form was detected after TRAIL treatment. 11 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey association association 3a TRAIL (induces cell death) and TPA (induces macrophage differentiation) treatment was required for the interaction to happen. Several isoforms of cflar (S and L, according to authors) are involved in this interaction. casp8-cflar-12 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait Processed (active) forms appear after CH11 anti-Fas agonistic antibody treatment. 9 unspecified role unspecified role prey prey association association 3b CH11 anti-Fas agonistic antibody (induces cell death) and TPA (induces macrophage differentiation) treatment was required for the interaction to happen. Several isoforms of cflar (S and L, according to authors) are detected in this experiment. casp8-cflar-11 2 10 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey A processed form was detected after TNF-alpha treatment. 9 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait Processed (active) forms appear after TNF-alpha treatment. 6 unspecified role unspecified role prey prey association association 3c TNF-alpha (induces cell death) and TPA (induces macrophage differentiation) treatment was required for the interaction to happen.