IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Science (0036-8075) 2006 imex curation Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The experiment was performed using mouse embryonic fibroblasts knocked-down for Bax and Bak. The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu Accepted 2012-MAR-27 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2006 Only protein-protein interactions imex curation Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Science (0036-8075) 2006 imex curation Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down weight silver stain molecular weight estimation by silver staining weight silver stain Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu Accepted 2012-MAR-27 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2006 Only protein-protein interactions imex curation Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Science (0036-8075) 2006 imex curation Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu Accepted 2012-MAR-27 by ORCHARD Science (0036-8075) 2006 Only protein-protein interactions imex curation Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Science (0036-8075) 2006 imex curation Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu Accepted 2012-MAR-27 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2006 Only protein-protein interactions imex curation Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Science (0036-8075) 2006 imex curation Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu Accepted 2012-MAR-27 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2006 Only protein-protein interactions imex curation Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Proapoptotic BAX and BAK modulate the unfolded protein response by a direct interaction with IRE1alpha. Science (0036-8075) 2006 imex curation Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hetz C., Bernasconi P., Fisher J., Lee A.H., Bassik M.C., Antonsson B., Brandt G.S., Iwakoshi N.N., Schinzel A., Glimcher L.H., Korsmeyer S.J. Apoptosis - Interactions involving proteins with a function related to apoptosis The information about the origin of the Bax and ern1 purified proteins and about the ern1 construct used to permanently transfect the MEFs used in the co-immunoprecipitation stuides was provided by the authors upon email request. lglimche@hsph.harvard.edu; chetz@hsph.harvard.edu Accepted 2012-MAR-27 by ORCHARD 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2006 Only protein-protein interactions imex curation bip_mouse Endoplasmic reticulum chaperone BiP Immunoglobulin heavy chain-binding protein Hspa5 Grp78 78 kDa glucose-regulated protein Binding-immunoglobulin protein Heat shock protein 70 family protein 5 Heat shock protein family A member 5 protein protein mouse Mus musculus Mouse MMKFTVVAAALLLLGAVRAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNGVFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALSSQHQARIEIESFFEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVCPLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIERMVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEEKIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSGGPPPTGEEDTSEKDEL DIP protein P20029 original sequence version: 154 DIP protein P20029 original sequence version: 113 DIP protein P20029 original sequence version: 112 DIP protein P20029 original sequence version: 117 DIP protein P20029 original sequence version: 165 AFB795D15E20FAC2 ern1_mouse Serine/threonine-protein kinase/endoribonuclease IRE1 Ern1 Ire1 Endoplasmic reticulum-to-nucleus signaling 1 Inositol-requiring protein 1 Ire1-alpha protein protein mouse Mus musculus Mouse MPARWLLLLLALLLPPPGPGSFGRTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDPVLQVPTHVEEPAFLPDPNDGSLYTLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYFDYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQGEVLRKVVHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDLKFDPGLKGKSKLNYLRNYWLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKRSFEEVINIVGQTSDNTPTTVSQDVEEKLARAPAKPEAPVDSMLKDMATIILSTFLLVGWVAFIITYPLSVHQQRQLQHQQFQKELEKIQLLQQQQLPFHPHGDLTQDPEFLDSSGPFSESSGTSSPSPSPRASNHSLHPSSSASRAGTSPSLEQDDEDEETRMVIVGKISFCPKDVLGHGAEGTIVYKGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLHQTTSGLAHLHSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPEMLSEDCKDNPTYTVDIFSAGCVFYYVISEGNHPFGKSLQRQANILLGACNLDCFHSDKHEDVIARELIEKMIAMDPQQRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKEALDGPIVRQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPVEVQETLGSIPDDFVRYFTSRFPHLLSHTYQAMELCRHERLFQTYYWHEPTEPQPPVIPYAL 216E3E2FA2FF3F70 bak_mouse Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bak1 Bak protein protein mouse Mus musculus Mouse MASGQGPGPPKVGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDNLPLEPNSILGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSGISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALNFRRDPILTVMVIFGVVLLGQFVVHRFFRS DIP protein O08734 original sequence version: 116 DIP protein O08734 original sequence version: 66 DIP protein O08734 original sequence version: 114 DIP protein O08734 original sequence version: 129 49972D3CA21F4218 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 bax_mouse Apoptosis regulator BAX Bax protein protein mouse Mus musculus Mouse MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG D2E0B3566579FAFF ern1_human Serine/threonine-protein kinase/endoribonuclease IRE1 ERN1 Inositol-requiring protein 1 Ire1-alpha Endoplasmic reticulum-to-nucleus signaling 1 IRE1 protein protein human Homo sapiens Human MPARRLLLLLTLLLPGLGIFGSTSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDPVLQVPTHVEEPAFLPDPNDGSLYTLGSKNNEGLTKLPFTIPELVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYFDYAASLPEDDVDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKVMHINVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSRDVEEKPAHAPARPEAPVDSMLKDMATIILSTFLLIGWVAFIITYPLSMHQQQQLQHQQFQKELEKIQLLQQQQQQLPFHPPGDTAQDGELLDTSGPYSESSGTSSPSTSPRASNHSLCSGSSASKAGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPYYFHEPPEPQPPVTPDAL A2DF808CCE015536 ern1-bax 3 12 unspecified role unspecified role bait bait cytosolic domain required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range There are two tandem HA sequences at the C-terminal domain and a precision enzyme site before the HA tag. 11 unspecified role unspecified role prey prey physical association physical association 4b ern1-bak1 3 12 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range There are two tandem HA sequences at the C-terminal domain and a precision enzyme site before the HA tag. 9 unspecified role unspecified role prey prey physical association physical association S5b bax-ern1 5 12 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait physical association physical association S5c bax-ern1 4 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 4c Treatment of the cells with tunicamycin (induces ER stress) increases the interaction. ern1-bak1-1 1 12 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range There are two tandem HA sequences at the C-terminal domain and a precision enzyme site before the HA tag. 9 unspecified role unspecified role prey prey O08734:p.Leu76Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E Wed May 02 18:40:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu76glu' Tue Jun 30 17:28:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu76Glu' O08734:p.[Trp123Ala;Gly124Glu] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain G E Wed May 02 19:06:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp123ala,gly124glu' Tue Jun 30 19:37:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp123Ala;Gly124Glu]' physical association physical association 4d ern1-hspa5-2 1 12 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range There are two tandem HA sequences at the C-terminal domain and a precision enzyme site before the HA tag. n-terminal fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association 4g (right), 4h, and S6c (right) The interaction is decreased by tunicamycin treatment (induces ER stress). ern1-bip-5 3 12 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range There are two tandem HA sequences at the C-terminal domain and a precision enzyme site before the HA tag. n-terminal fragment sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association S6c (left) and 4g (left) The interaction is decreased by tunicamycin treatment (induces ER stress). bax-ern1-1 6 10 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range cytosolic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 4a bax-ern1-2 2 10 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait purified purified cytosolic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction S5a right