IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The arginine methyltransferase PRMT2 binds RB and regulates E2F function. The arginine methyltransferase PRMT2 binds RB and regulates E2F function. Exp. Cell Res. (0014-4827) 2006 Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov 10-APR-2007: Contacted by JYOTI. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov Accepted 2007-APR-12 by DAVET. 10-APR-2007: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2006 The arginine methyltransferase PRMT2 binds RB and regulates E2F function. The arginine methyltransferase PRMT2 binds RB and regulates E2F function. Exp. Cell Res. (0014-4827) 2006 Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov 10-APR-2007: Contacted by JYOTI. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov Accepted 2007-APR-12 by DAVET. 10-APR-2007: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2006 The arginine methyltransferase PRMT2 binds RB and regulates E2F function. The arginine methyltransferase PRMT2 binds RB and regulates E2F function. Exp. Cell Res. (0014-4827) 2006 Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov 10-APR-2007: Contacted by JYOTI. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov Accepted 2007-APR-12 by DAVET. 10-APR-2007: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2006 The arginine methyltransferase PRMT2 binds RB and regulates E2F function. The arginine methyltransferase PRMT2 binds RB and regulates E2F function. Exp. Cell Res. (0014-4827) 2006 Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov 10-APR-2007: Contacted by JYOTI. human-saos-2 Homo sapiens SAOS-2 cell line established from primary osteogenic sarcoma saos-2 Homo sapiens SAOS-2 cell line established from primary osteogenic sarcoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov Accepted 2007-APR-12 by DAVET. 10-APR-2007: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2006 The arginine methyltransferase PRMT2 binds RB and regulates E2F function. The arginine methyltransferase PRMT2 binds RB and regulates E2F function. Exp. Cell Res. (0014-4827) 2006 Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation Apoptosis - Interactions involving proteins with a function related to apoptosis Cancer - Interactions investigated in the context of cancer The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov 10-APR-2007: Contacted by JYOTI. mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Yoshimoto T., Boehm M., Olive M., Crook MF., San H., Langenickel T., Nabel EG. Chromatin - Epigenetic interactions resulting in chromatin modulation The CMV-RB construct was found by internet searches to encode the human protein. A number of publications describe the construct e.g., J Virol 2002 76(12) 6224-34. nabele@nih.gov Accepted 2007-APR-12 by DAVET. 10-APR-2007: Contacted by JYOTI. Exp. Cell Res. (0014-4827) 2006 rb_mouse Retinoblastoma-associated protein Rb1 Rb-1 pRb pp105 p110-RB1 protein protein mouse Mus musculus Mouse MPPKAPRRAAAAEPPPPPPPPPREDDPAQDSGPEELPLARLEFEEIEEPEFIALCQKLKVPDHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEMPFTFTELQKSIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSALSTEINSMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVVDYFIKFSPPALLREPYKTAAIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFINSLGIVSSNGLPEVESLSKRYEEVYLKNKDLDARLFLDHDKTLQTDPIDSFETERTPRKNNPDEEANVVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFNNCTVNPKENILKRVKDVGHIFKEKFANAVGQGCVDIGVQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTLQHLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDNLEPACPLSLPLQGNHTAADMYLSPLRSPKKRTSTTRVNSAANTETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGADEADGSKHLPAESKFQQKLAEMTSTRTRMQKQRMNESKDVSNKEEK DIP protein P13405 original sequence version: 115 DIP protein P13405 original sequence version: 114 DIP protein P13405 original sequence version: 110 AE81D35A07ADB493 rb_human Retinoblastoma-associated protein pRb pp110 p105-Rb RB1 p110-RB1 protein protein human Homo sapiens Human MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFEETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLLAKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK DIP protein P06400 original sequence version: 102 DIP protein P06400 original sequence version: 195 DIP protein P06400 original sequence version: 204 DIP protein P06400 original sequence version: 126 DIP protein P06400 original sequence version: 151 DIP protein P06400 original sequence version: 153 DIP protein P06400 original sequence version: 181 DIP protein P06400 original sequence version: 184 DIP protein P06400 original sequence version: 213 DIP protein P06400 original sequence version: 208 DIP protein P06400 original sequence version: 174 DIP protein P06400 original sequence version: 212 DIP protein P06400 original sequence version: 179 DIP protein P06400 original sequence version: 146 C8E746111E19CC32 e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF DIP protein Q01094 original sequence version: 173 DIP protein Q01094 original sequence version: 168 DIP protein Q01094 original sequence version: 149 DIP protein Q01094 original sequence version: 130 DIP protein Q01094 original sequence version: 125 DIP protein Q01094 original sequence version: 153 DIP protein Q01094 original sequence version: 180 003B3F654F0C60DF anm2_mouse Protein arginine N-methyltransferase 2 Prmt2 Hrmt1l1 Histone-arginine N-methyltransferase PRMT2 protein protein mouse Mus musculus Mouse MEAPGEGPCSESQVIPVLEEDPVDYGCEMQLLQDGAQLQLQLQPEEFVAIADYTATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHLGKQLEEYDPEDTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAYEFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQPQQVVSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVHGFCCVTKKSGMEKAHVCLSELGCHVRTRSHVSTELETGSFRSGGDS 63E1F8C3FC66C25E anm2_human Protein arginine N-methyltransferase 2 PRMT2 HMT1 Histone-arginine N-methyltransferase PRMT2 HRMT1L1 protein protein human Homo sapiens Human MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR 6DEE0350C15ECD4F rb1-prmt2 2 10 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction 1 A, 2 B We found that PRMT2 directly interacts with RB, in contrast to PRMT1, PRMT3 and PRMT4 PRMT1, 3 and 4 do not interact with GST-pRb. The AdoMet domain of PRMT2 contained in the region aa 96-218 is required for binding to pRb. rb1-prmt2-1 1 7 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey physical association physical association 1 C HA-tagged PRMT2 expression vectors or control vectors were transfected into 293 cells, and immunoprecipitation of endogenous RB was followed by a Western blot analysis using an anti-HA antibody. PRMT2 directly interacted with RB in contrast to control vectors P55345 transfection rb1-prmt2-2 3 7 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 2 C P55345 transfection P55345 overexpressed The PRMT2 AdoMet domain contained in the region aa 96-218 is required for binding to pRb. Full-length PRMT2 interacted with RB, while the deletion mutant did not e2f1-prmt2 4 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 4 A In cells transfected with E2F1, PRMT2 and RB, PRMT2 co-immunoprecipitated with E2F1 This interaction only occurred in the presence of pRb. Q01094; P55345 transfection prmt2-rb1 5 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 6 D We observed the presence of RB in immunoprecipitates of endogenous PRMT2 from PRMT2+/+ MEFs