IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. Cell (0092-8674) 2006 imex curation Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis berto@bcm.tmc.edu 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 in vitro In vitro pull down pull down predetermined predetermined participant predetermined Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis 1D and E 1D berto@bcm.tmc.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. Cell (0092-8674) 2006 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 imex curation The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. Cell (0092-8674) 2006 imex curation Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis berto@bcm.tmc.edu 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip ms participant Identification by mass spectrometry ms participant Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis Nuclear extracts from Hela cells used. 1A berto@bcm.tmc.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. Anti SRC-3 antibody used. Cell (0092-8674) 2006 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 imex curation The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. Cell (0092-8674) 2006 imex curation Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis berto@bcm.tmc.edu 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis revisit when compelx interactions possible - 20Sproteasome mediates SRC-3 degradation. 1C berto@bcm.tmc.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. Cell (0092-8674) 2006 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 imex curation The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. The SRC-3/AIB1 coactivator is degraded in a ubiquitin- and ATP-independent manner by the REGgamma proteasome. Cell (0092-8674) 2006 imex curation Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis berto@bcm.tmc.edu 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Li X., Lonard DM., Jung SY., Malovannaya A., Feng Q., Qin J., Tsai SY., Tsai MJ., O'Malley BW. Apoptosis - Interactions involving proteins with a function related to apoptosis Cell lysates used. 1B berto@bcm.tmc.edu Annotation to indicate that this entry has been checked and accepted by a senior curator. Anti SRC-3 antibody used. Cell (0092-8674) 2006 1291..1291 1291..1301 2006-07-10: Only interaction involving solely Proteins were exported. Only protein-protein interactions 5 imex curation ncoa3_human Nuclear receptor coactivator 3 NCOA3 AIB1 RAC3 Thyroid hormone receptor activator molecule 1 Receptor-associated coactivator 3 BHLHE42 Steroid receptor coactivator protein 3 CBP-interacting protein Amplified in breast cancer 1 protein ACTR Class E basic helix-loop-helix protein 42 TRAM1 protein protein human Homo sapiens Human MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRCIQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLADPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSPKIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKESSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQEKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLKSSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGSSMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPTLPLRSNSIPGARPVLQQQQQMLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENPTAGGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPTMPQAPPQQFPYQPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC DIP protein Q9Y6Q9 original sequence version: 162 DIP protein Q9Y6Q9 original sequence version: 155 DIP protein Q9Y6Q9 original sequence version: 91 732CDF0423161679 psme3_human Proteasome activator complex subunit 3 PSME3 Proteasome activator 28 subunit gamma Activator of multicatalytic protease subunit 3 11S regulator complex subunit gamma Ki nuclear autoantigen protein protein human Homo sapiens Human MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY 116FAB47D60A26C0 ncoa3-psme3 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association ncoa3-psme3-1 4 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association ncoa3-psme3-2 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Q9Y6Q9 transient transfection Q6UW15 endogenous ncoa3-psme3-3 1 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hat domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction ncoa3-psme3-4 1 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined hat domain binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction