IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Genes Dev. (0890-9369) 2005 Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Genes Dev. (0890-9369) 2005 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Genes Dev. (0890-9369) 2005 Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Genes Dev. (0890-9369) 2005 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Genes Dev. (0890-9369) 2005 Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Genes Dev. (0890-9369) 2005 Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Proapoptotic Bak is sequestered by Mcl-1 and Bcl-xL, but not Bcl-2, until displaced by BH3-only proteins. Genes Dev. (0890-9369) 2005 Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Willis SN., Chen L., Dewson G., Wei A., Naik E., Fletcher JI., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Binding of protein 1 to the competitor peptide protein 2 competes with its binding to immobilized peptide ligand. Strength of interaction between protein 1 and protein 2 is given by a measure (IC50) of the inhibition of the interaction between protein 1 and immobilized peptide. 3A and 4A huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Genes Dev. (0890-9369) 2005 bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F mcl1_mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Bcl-2-related protein EAT/mcl1 Mcl1 protein protein mouse Mus musculus Mouse MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein P97287 original sequence version: 123 E4FD369DB0EC6723 bak_human Bcl-2 homologous antagonist/killer Apoptosis regulator BAK Bcl-2-like protein 7 BAK1 BAK BCL2L7 CDN1 protein protein human Homo sapiens Human MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS DIP protein Q16611 original sequence version: 74 DIP protein Q16611 original sequence version: 162 DIP protein Q16611 original sequence version: 97 DIP protein Q16611 original sequence version: 158 DIP protein Q16611 original sequence version: 151 DIP protein Q16611-1 original sequence version: 178 DIP protein Q16611-1 original sequence version: 180 DIP protein Q16611 original sequence version: 121 A2200FE72A46D04E apr_human Phorbol-12-myristate-13-acetate-induced protein 1 NOXA Immediate-early-response protein APR PMAIP1 Protein Noxa protein protein human Homo sapiens Human MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT 291A142B27167E70 bak-mcl1-1 2 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:45:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu78ala' Tue Jun 30 15:39:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu78Ala' in vitro In vitro direct interaction direct interaction IC50=8nM bak-bclxl-2 2 9 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:13:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu78ala' Tue Jun 30 17:10:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu78Ala' in vitro In vitro 6 unspecified role unspecified role prey prey direct interaction direct interaction IC50=50nM bak-mcl1-2 4 9 unspecified role unspecified role prey prey in vitro In vitro 8 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association bak-bclxl-3 4 9 unspecified role unspecified role prey prey in vitro In vitro 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association bak-mcl1-3 1 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association bak-bclxl-4 1 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey in vitro In vitro direct interaction direct interaction bak-mcl1-4 4 9 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:55:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu78ala' Tue Jun 30 16:55:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu78Ala' in vitro In vitro 7 unspecified role unspecified role prey prey physical association physical association bak-bax-1 4 9 unspecified role unspecified role bait bait Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:13:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu78ala' Tue Jun 30 15:42:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu78Ala' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 5 unspecified role unspecified role prey prey physical association physical association bak-1 4 9 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q16611:p.Leu78Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Wed May 02 19:11:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu78ala' Tue Jun 30 17:17:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu78Ala' direct interaction direct interaction pmaip1-mcl1-1 4 10 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q13794:p.Leu36Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E Wed May 02 15:17:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu36glu' Tue Jun 30 20:08:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu36Glu' Q13794:p.Phe32Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F E Wed May 02 15:39:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe32glu' Tue Jun 30 19:30:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe32Glu' Q13794:p.Leu29Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E Wed May 02 14:56:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu29glu' Tue Jun 30 19:53:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu29Glu' 7 unspecified role unspecified role prey prey physical association physical association Appears to bind to MCL1 in competition with BAK bak-mcl1-5 3 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction By PMAIP1 (Q13794) - a BH3 domain peptide compete for binding to MCL-1 with BAK