IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Mol. Cell (1097-2765) 2005 Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis no Interactions do not occur when wild-type PMAIP1 (NOXA) is used - only mutated protein will interact. Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell (1097-2765) 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Mol. Cell (1097-2765) 2005 Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell (1097-2765) 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Mol. Cell (1097-2765) 2005 Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell (1097-2765) 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Mol. Cell (1097-2765) 2005 Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell (1097-2765) 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Mol. Cell (1097-2765) 2005 Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip monoclonal western monoclonal antibody western blot monoclonal western Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis no Interactions do not occur when wild-type PMAIP1 (NOXA) is used - only mutated protein will interact. Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell (1097-2765) 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Mol. Cell (1097-2765) 2005 Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis I have only added the competing peptide - free protein interaction data for those interactions given in the text as positive, I have not transcribed the entire table. Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell (1097-2765) 2005 Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Differential targeting of prosurvival Bcl-2 proteins by their BH3-only ligands allows complementary apoptotic function. Mol. Cell (1097-2765) 2005 Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Chen L., Willis SN., Wei A., Smith BJ., Fletcher JI., Hinds MG., Colman PM., Day CL., Adams JM., Huang DC. Apoptosis - Interactions involving proteins with a function related to apoptosis Cells were labelled with S35 to ensure immunoprecipitation of equivalent lysates and to allow participant detection by flurography 4A, 4B, 4C, 4D huang_d@wehi.edu.au Annotation to indicate that this entry has been checked and accepted by a senior curator. Mol. Cell (1097-2765) 2005 b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 bcl2_human Apoptosis regulator Bcl-2 BCL2 protein protein human Homo sapiens Human MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK DIP protein P10415 original sequence version: 148 DIP protein P10415 original sequence version: 125 DIP protein P10415 original sequence version: 151 DIP protein P10415 original sequence version: 204 DIP protein P10415 original sequence version: 149 3C49F2B714DC9CCB hrk_human Activator of apoptosis harakiri Neuronal death protein DP5 BH3-interacting domain-containing protein 3 HRK BID3 protein protein human Homo sapiens Human MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL 22E45FA2B0B7AA00 q07817-1 Bcl-2-like protein 1 BCLX Apoptosis regulator Bcl-X BCL2L1 BCL2L Bcl-xL protein protein human Homo sapiens Human MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK DIP protein Q07817 original sequence version: 82 DIP protein Q07817 original sequence version: 86 DIP protein Q07817-1 original sequence version: 100 DIP protein Q07817-1 original sequence version: 108 DIP protein Q07817 original sequence version: 131 DIP protein Q07817-1 original sequence version: 110 DIP protein Q07817-1 original sequence version: 135 DIP protein Q07817-1 original sequence version: 131 DIP protein Q07817-1 original sequence version: 172 DIP protein Q07817-1 original sequence version: 174 DIP protein Q07817 original sequence version: 174 DIP protein Q07817-1 original sequence version: 189 DIP protein Q07817-1 original sequence version: 192 DIP protein Q07817 original sequence version: 190 E09D3CDD851AE9BE mcl1_mouse Induced myeloid leukemia cell differentiation protein Mcl-1 homolog Bcl-2-related protein EAT/mcl1 Mcl1 protein protein mouse Mus musculus Mouse MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein P97287 original sequence version: 123 E4FD369DB0EC6723 apr_human Phorbol-12-myristate-13-acetate-induced protein 1 NOXA Immediate-early-response protein APR PMAIP1 Protein Noxa protein protein human Homo sapiens Human MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT 291A142B27167E70 o43521-2 Bcl-2-like protein 11 Bim(L) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH 8BB4AAE06CB080FA b2l11_mouse Bcl-2-like protein 11 Bcl2-interacting mediator of cell death Bcl2l11 Bim protein protein mouse Mus musculus Mouse MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH DIP protein O54918 original sequence version: 130 531C176E5F1AC9AA o43521-1 Bcl-2-like protein 11 Bim(EL) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH D75735E469CA6997 apr_mouse Phorbol-12-myristate-13-acetate-induced protein 1 Pmaip1 Noxa Protein Noxa protein protein mouse Mus musculus Mouse MPGRKARRNAPVNPTRAELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRMRSPSPTRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT DIP protein Q9JM54 original sequence version: 102 DIP protein Q9JM54 original sequence version: 115 9B9A5B04D5535E30 b2la1_mouse Bcl-2-related protein A1 Protein BFL-1 Hemopoietic-specific early response protein A1-A Bcl2a1 A1 Bcl2a1a Bfl1 protein protein mouse Mus musculus Mouse MAESELMHIHSLAEHYLQYVLQVPAFESAPSQACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVCAYKQVSSFVAEFIMNNTGEWIRQNGGWEDGFIKKFEPKSGWLTFLQMTGQIWEMLFLLK DIP protein Q07440 original sequence version: 62 37AD35818E756488 bik_human Bcl-2-interacting killer Apoptosis inducer NBK BP4 BIP1 BIK NBK protein protein human Homo sapiens Human MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK DIP protein Q13323 original sequence version: 131 DIP protein Q13323 original sequence version: 119 89034F4443F5A136 bmf_mouse Bcl-2-modifying factor Bmf protein protein mouse Mus musculus Mouse MEPPQCVEELEDDVFQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQVFLFLQNLALNRQENREGVGPW DIP protein Q91ZE9 original sequence version: 42 DAE6EA080F3EA06B bbc3_human Bcl-2-binding component 3, isoforms 1/2 p53 up-regulated modulator of apoptosis JFY-1 BBC3 PUMA protein protein human Homo sapiens Human MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN DIP protein Q9BXH1 original sequence version: 32 3585527F1858A4FA bad_mouse Bcl2-associated agonist of cell death Bad Bbc6 Bcl-2-binding component 6 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein mouse Mus musculus Mouse MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASATDRGLGPSLTEDQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ DIP protein Q61337 original sequence version: 60 6C2BA910205053F7 bad_human Bcl2-associated agonist of cell death Bcl-2-binding component 6 Bcl-2-like protein 8 BAD BBC6 BCL2L8 Bcl-xL/Bcl-2-associated death promoter Bcl2 antagonist of cell death protein protein human Homo sapiens Human MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ DIP protein Q92934 original sequence version: 66 DIP protein Q92934 original sequence version: 121 69FD8D27DDEE3241 b2cl2_human Bcl-2-like protein 2 Apoptosis regulator Bcl-W BCL2L2 BCLW KIAA0271 protein protein human Homo sapiens Human MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK DIP protein Q92843 original sequence version: 103 DIP protein Q92843 original sequence version: 85 DIP protein Q92843 original sequence version: 112 3542243A532B1762 bid_human BH3-interacting domain death agonist p22 BID BID protein protein human Homo sapiens Human MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD DIP protein P55957 original sequence version: 105 DIP protein P55957 original sequence version: 114 DIP protein P55957-1 original sequence version: 132 DIP protein P55957 original sequence version: 144 B17A07334C1AFBEF bim-bcl2 3 9 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 29 31 direct interaction direct interaction bim-bclxl-1 3 15 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 36 34 direct interaction direct interaction bim-bclw-1 3 24 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-707740]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 209-209, sequence length 193 [EBI-707740]1-209 ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 42 40 direct interaction direct interaction bim-mcl1-1 3 12 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain O54918:p.Ile146Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E Fri Jul 22 10:56:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'iso146glu' Wed May 02 20:03:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile146glu' Tue Jun 30 19:19:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile146Glu' O54918:p.Leu150Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E Wed May 02 16:55:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu150glu' Tue Jun 30 15:59:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu150Glu' O54918:p.Ile153Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E Fri Jul 22 11:12:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'iso153glu' Wed May 02 16:01:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile153glu' Tue Jun 30 16:06:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile153Glu' O54918:p.Phe157Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F E Wed May 02 17:29:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe157glu' Tue Jun 30 18:07:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe157Glu' 48 46 direct interaction direct interaction bim-bcl2a1-1 3 15 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 18 unspecified role unspecified role prey prey region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 55 57 direct interaction direct interaction bim-bclxl-2 6 8 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 60 62 direct interaction direct interaction IC50=4.6nM bim-bcl2-2 6 8 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 67 65 direct interaction direct interaction IC50=2.6nM bim-bclw-2 6 24 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-707859]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 209-209, sequence length 193 [EBI-707859]1-209 n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 71 74 direct interaction direct interaction IC50=4.3nM bim-mcl1-2 6 12 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction IC50=2.4nM bim-bcl2a1-2 6 18 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 82 84 direct interaction direct interaction IC50=4.3nM bbc3-bclxl-1 6 21 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 89 87 direct interaction direct interaction IC50=6.3nM bbc3-bcl2-4 6 21 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction IC50=3.3nM bbc3-bclw-1 6 24 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-707973]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 209-209, sequence length 193 [EBI-707973]1-209 n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 98 101 direct interaction direct interaction IC50=5.1nM bbc3-mcl1-1 6 21 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 104 106 direct interaction direct interaction IC50=5.0nM bbc3-bcl2a1-1 6 18 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 109 111 direct interaction direct interaction IC50=5.7nM bmf-bcl2-1 6 9 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 115 117 direct interaction direct interaction IC50=3.0nM bmf-bclxl-1 6 20 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 120 122 direct interaction direct interaction IC50=9.7nM bmf-bclw-1 6 20 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 24 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-708071]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 209-209, sequence length 193 [EBI-708071]1-209 n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 125 127 direct interaction direct interaction IC50=9.8nM bad-bcl2-3 6 23 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 9 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction IC50=16.0nM bad-bclxl-2 6 23 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 11 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 139 137 direct interaction direct interaction IC50=5.3nM bad-bclw-1 6 24 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-708104]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 209-209, sequence length 193 [EBI-708104]1-209 ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 145 143 direct interaction direct interaction IC50=30nM bik-bclxl-2 6 11 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 150 148 direct interaction direct interaction IC50=43nM bik-bclw-2 6 19 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 24 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-708129]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 209-209, sequence length 193 [EBI-708129]1-209 ecoli Escherichia coli (strain K12) 156 153 direct interaction direct interaction IC50=12nM bik-bcl2a1-1 6 18 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro direct interaction direct interaction IC50=58nM hrk-bclxl-1 6 11 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 166 164 direct interaction direct interaction IC50=3.7nM hrk-bclw-1 6 10 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 24 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-708159]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 209-209, sequence length 193 [EBI-708159]1-209 n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction IC50=49nM hrk-bcl2a1-3 6 18 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 175 177 direct interaction direct interaction IC50=46nM bid-bclxl-2 6 11 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 25 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 182 180 direct interaction direct interaction IC50=82nM bid-bclw-2 6 24 unspecified role unspecified role neutral component neutral component n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-708190]Certain and ragged-n-terminus positions must always be strictly superior to 0 and inferior or equal to the protein sequence length. Actual positions : 209-209, sequence length 193 [EBI-708190]1-209 ecoli Escherichia coli (strain K12) 25 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 188 186 direct interaction direct interaction IC50=40nM bid-bcl2a1-2 6 25 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction IC50=9.3nM pmaip1-mcl1-2 6 12 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 198 196 direct interaction direct interaction IC50=24.0nM pmaip1-bcl2a1-1 6 13 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 18 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction IC50=180nM bim-bcl2-1 7 14 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bim-bcl2-3 7 14 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bclxl-bim-3 7 16 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association bclxl-bim-4 7 11 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 16 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association bim-mcl1-3 7 8 unspecified role unspecified role bait bait n-termunis ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bim-mcl1-4 7 8 unspecified role unspecified role prey prey n-termunis ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged deletion analysis deletion analysis n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bbc3-bcl2-5 7 9 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro direct interaction direct interaction bbc3-bcl2-6 7 21 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 9 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bbc3-bclxl-2 7 11 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bbc3-bclxl-3 7 11 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bbc3-mcl1-2 7 12 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bbc3-mcl1-3 7 12 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 21 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bik-bclxl-3 7 19 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bik-bclxl-4 7 19 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bad-bclxl-3 2 22 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bad-bcl2-4 2 22 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bad-bcl2-5 2 9 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction pmaip1-mcl1-3 2 17 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction pmaip1-mcl1-4 2 17 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction mcl1-bim-1 4 8 unspecified role unspecified role bait bait O43521:p.Ile155Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E Wed May 02 18:57:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile155glu' Tue Jun 30 16:10:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile155Glu' O43521:p.Leu152Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E Wed May 02 17:11:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152glu' Tue Jun 30 20:20:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Glu' O43521:p.Ile148Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E Fri Jul 22 11:11:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'iso148glu' Wed May 02 15:34:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile148glu' Tue Jun 30 15:44:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile148Glu' O43521:p.Phe159Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F E Wed May 02 16:54:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe159glu' Tue Jun 30 19:31:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe159Glu' 12 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association The actual BIM protein used in the assay appears to be an isoform, BIM-S, currently missing in UniProt. Interaction also occurs when BH3 domain of BIM-S replaced by the corresponding domains from BBC3 (PUMA) and BAD Revisit to make chimeric proteins when isoform is in UniProt, mutant renumbering done vs parent entry. bclxl-bim-6 4 8 unspecified role unspecified role bait bait O43521:p.Ile155Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E Fri Jul 22 10:59:36 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'iso155glu' Wed May 02 14:53:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile155glu' Tue Jun 30 18:11:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile155Glu' O43521:p.Leu152Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L E Wed May 02 16:30:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu152glu' Tue Jun 30 18:04:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu152Glu' O43521:p.Ile148Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I E Fri Jul 22 11:08:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'iso148glu' Wed May 02 15:47:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile148glu' Tue Jun 30 18:29:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile148Glu' O43521:p.Phe159Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F E Wed May 02 14:26:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe159glu' Tue Jun 30 19:06:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe159Glu' 11 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association The actual BIM protein used in the assay appears to be an isoform, BIM-S, currently missing in UniProt. Interaction also occurs when BH3 domain of BIM-S replaced by the corresponding domains from BBC3 (PUMA) and BAD Revisit to make chimeric proteins when isoform is in UniProt, mutant renumbering done vs parent entry. pmaip1-bclxl-1 1 11 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q13794:p.Lys35Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 17:31:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys35glu' Tue Jun 30 17:11:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys35Glu' Q13794:p.Phe32Ile mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F I Fri Jul 22 11:10:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe32iso' Wed May 02 18:32:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe32ile' Tue Jun 30 18:48:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe32Ile' in vitro In vitro direct interaction direct interaction IC50=110nM (=>100,000nM in absence of mutants) pmaip1-bclw-1 1 13 unspecified role unspecified role neutral component neutral component Q13794:p.Lys35Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:58:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys35glu' Tue Jun 30 18:01:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys35Glu' Q13794:p.Phe32Ile mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F I Fri Jul 22 11:03:06 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe32iso' Wed May 02 17:21:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe32ile' Tue Jun 30 17:43:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe32Ile' region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain in vitro In vitro 24 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction IC50=410nM (=>100,000nM in absence of mutants) pmaip1-bclxl-2 5 11 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 13 unspecified role unspecified role prey prey Q13794:p.Lys35Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 19:20:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys35glu' Tue Jun 30 17:35:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys35Glu' Q13794:p.Phe32Ile mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F I Fri Jul 22 11:14:14 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'phe32iso' Wed May 02 14:44:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe32ile' Tue Jun 30 17:05:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe32Ile' direct interaction direct interaction pmaip1-bclw-2 5 13 unspecified role unspecified role prey prey Q13794:p.Phe32Ile mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F I Wed May 02 15:10:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe32ile' Tue Jun 30 18:43:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe32Ile' Q13794:p.Lys35Glu mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K E Wed May 02 16:15:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys35glu' Tue Jun 30 17:18:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys35Glu' in vitro In vitro 24 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction bad-bcl2-6 7 22 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bad-bcl2-7 7 9 unspecified role unspecified role prey prey n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction bad-bclxl-5 7 11 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 22 unspecified role unspecified role prey prey n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction