IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Coupled in vitro import of U snRNPs and SMN, the spinal muscular atrophy protein. Coupled in vitro import of U snRNPs and SMN, the spinal muscular atrophy protein. Mol. Cell (1097-2765) 2004 Narayanan U., Achsel T., Luhrmann R., Matera AG. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Narayanan U., Achsel T., Luhrmann R., Matera AG. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 Coupled in vitro import of U snRNPs and SMN, the spinal muscular atrophy protein. Coupled in vitro import of U snRNPs and SMN, the spinal muscular atrophy protein. Mol. Cell (1097-2765) 2004 Narayanan U., Achsel T., Luhrmann R., Matera AG. Apoptosis - Interactions involving proteins with a function related to apoptosis in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Narayanan U., Achsel T., Luhrmann R., Matera AG. Apoptosis - Interactions involving proteins with a function related to apoptosis Accepted 2010-JAN-10 by SKERRIEN (applied to all records created before 2005-Sep-01). Mol. Cell (1097-2765) 2004 q16637-3 Survival motor neuron protein Iso7-SMN SMN1 SMN2 SMN SMNT SMNC Component of gems 1 Gemin-1 protein protein human Homo sapiens Human MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMEMLA Thought to be a non-functional protein that lacks the capacity to oligomerize and thus cannot interact with Sm proteins. Primarily derived from SMN2 gene. D79F1C206C884461 spf30_human Survival of motor neuron-related-splicing factor 30 SMN-related protein 30 kDa splicing factor SMNrp Survival motor neuron domain-containing protein 1 SMNDC1 SMNR SPF30 protein protein human Homo sapiens Human MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ 7F60852AD4D1F53A imb1_human Importin subunit beta-1 Karyopherin subunit beta-1 Nuclear factor p97 Importin-90 KPNB1 NTF97 Pore targeting complex 97 kDa subunit protein protein human Homo sapiens Human MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLQTLGTETYRPSSASQCVAGIACAEIPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEARPMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA F3BB8B73E7E51639 p14678-1 Small nuclear ribonucleoprotein-associated proteins B and B' SNRPB COD SNRPB1 Sm protein B/B' protein protein human Homo sapiens Human MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP F2E1D5E11A601170 smn-kpnb1 2 5 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 3 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association prey is present in cytoplasmic fraction smn-kpnb1-2 1 3 unspecified role unspecified role bait bait n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 5 unspecified role unspecified role prey prey human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association interaction between bait and prey are RNA dependent smn-kpnb1-3 2 3 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q16637-3:p.Glu134Lys disrupt interaction mutation mutation certain certain sequence position certain certain certain sequence position certain E K Wed May 02 20:15:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu134lys' Tue Jun 30 19:52:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu134Lys' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association smndc1-kpnb1 2 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association smndc1-kpnb1-2 2 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O75940:p.Glu133Lys disrupts interaction mutation mutation certain certain sequence position certain certain certain sequence position certain E K Wed May 02 20:08:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu133lys' Tue Jun 30 17:29:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu133Lys' ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey human Homo sapiens Human physical association physical association smn-kpnb1-4 2 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q16637-3:p.Tyr272Cys mutation mutation certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 16:02:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr272cys' Tue Jun 30 19:43:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr272Cys' ecoli Escherichia coli (strain K12) physical association physical association smn-kpnb1-5 2 5 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tudor binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-494100]range positions must always be strictly superior to 0 and inferior or equal to the sequence length. Actual positions : 151-515, sequence length 282 [EBI-494100]91-151..515 ecoli Escherichia coli (strain K12) physical association physical association smn-snrpb 2 3 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association smndc1-snrpb 2 4 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range O75940:p.Glu133Lys disrupts interaction mutation mutation certain certain sequence position certain certain certain sequence position certain E K Wed May 02 17:15:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu133lys' Tue Jun 30 18:07:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu133Lys' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association smn-snrpb-2 2 3 unspecified role unspecified role bait bait tudor binding region binding-associated region binding region deletion analysis deletion analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined [EBI-494101]range positions must always be strictly superior to 0 and inferior or equal to the sequence length. Actual positions : 151-515, sequence length 282 [EBI-494101]91-151..515 region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association smn-snrpb-3 2 6 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association