IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Induction of apoptosis by X-linked ectodermal dysplasia receptor via a caspase 8-dependent mechanism. Induction of apoptosis by X-linked ectodermal dysplasia receptor via a caspase 8-dependent mechanism. J. Biol. Chem. (0021-9258) 2004 Sinha SK., Chaudhary PM. Apoptosis - Interactions involving proteins with a function related to apoptosis The human 293T cell line used was stably transformed with a construct expressing the fusion protein FLAG epitope - Tumor necrosis factor receptor superfamily member 27 9XEDAR) protein human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip western blot western blot Immuno blot Immuno blot Sinha SK., Chaudhary PM. Apoptosis - Interactions involving proteins with a function related to apoptosis The human 293T cell line used was stably transformed with a construct expressing the fusion protein FLAG epitope - Tumor necrosis factor receptor superfamily member 27 9XEDAR) protein The human 293T cell line used was stably transformed with a construct expressing the fusion protein FLAG epitope - Tumor necrosis factor receptor superfamily member 27 9XEDAR) protein J. Biol. Chem. (0021-9258) 2004 q92851-3 Caspase-10 10-C CASP10 MCH4 Apoptotic protease Mch-4 FAS-associated death domain protein interleukin-1B-converting enzyme 2 ICE-like apoptotic protease 4 protein protein human Homo sapiens Human MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASDVFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLYELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPKLLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNEGSCVQDESEPQRPLCHCQQPQLYLPEGQTRNP May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. 1146630514EE38DC fadd_human FAS-associated death domain protein FAS-associating death domain-containing protein Mediator of receptor induced toxicity FADD MORT1 GIG3 Growth-inhibiting gene 3 protein protein protein human Homo sapiens Human MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS DIP protein Q13158 original sequence version: 155 DIP protein Q13158 original sequence version: 130 DIP protein Q13158 original sequence version: 110 DIP protein Q13158 original sequence version: 118 DIP protein Q13158 original sequence version: 141 DIP protein Q13158 original sequence version: 166 0E65E2F852E83507 traf3_human TNF receptor-associated factor 3 TRAF3 CAP1 CRAF1 CD40 receptor-associated factor 1 CD40-binding protein LMP1-associated protein 1 CAP-1 RING-type E3 ubiquitin transferase TRAF3 protein protein human Homo sapiens Human MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP DIP protein Q13114 original sequence version: 158 DIP protein Q13114 original sequence version: 127 DIP protein Q13114 original sequence version: 146 DIP protein Q13114 original sequence version: 151 9456E440C0A90FBF tnr27_human Tumor necrosis factor receptor superfamily member 27 UNQ2448/PRO5727/PRO34080 EDA2R TNFRSF27 XEDAR X-linked ectodysplasin-A2 receptor protein protein human Homo sapiens Human MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQSCITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAFQLSLVEADTPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEADKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCTSESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP 05DBB377DC59350C q14790-9 Caspase-8 CASP8 MCH5 Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog 8L protein protein human Homo sapiens Human MEGGRRARVVIESKRNFFLGAFPTPFPAEHVELGRLGDSETAMVPGKGGADYILLPFKKMDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLLITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRVILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD Ref.8 (AAL87628) sequence is in conflict in position: 14:K->R. 54402ECFA9FE5E14 traf6_human TNF receptor-associated factor 6 TRAF6 RNF85 Interleukin-1 signal transducer RING finger protein 85 E3 ubiquitin-protein ligase TRAF6 RING-type E3 ubiquitin transferase TRAF6 protein protein human Homo sapiens Human MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV DIP protein Q9Y4K3 original sequence version: 154 DIP protein Q9Y4K3 original sequence version: 91 DIP protein Q9Y4K3 original sequence version: 114 DIP protein Q9Y4K3 original sequence version: 118 DIP protein Q9Y4K3 original sequence version: 140 DIP protein Q9Y4K3 original sequence version: 159 DIP protein Q9Y4K3 original sequence version: 132 DIP protein Q9Y4K3 original sequence version: 158 DIP protein Q9Y4K3 original sequence version: 171 DIP protein Q9Y4K3 original sequence version: 117 DIP protein Q9Y4K3 original sequence version: 113 5AB9C255CCFEE749 xedar-traf6 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association This interaction was only detected in 293T cells treated with ectodysplasin-A2 (EDA-A2) as described within this paper. xedar-traf3 1 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association This interaction was only detected in 293T cells treated with ectodysplasin-A2 (EDA-A2) as described within this paper. xedar-casp8 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association This interaction was only detected in 293T cells treated with ectodysplasin-A2 (EDA-A2) as described within this paper. xedar-casp10 1 2 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association This interaction was only detected in 293T cells treated with ectodysplasin-A2 (EDA-A2) as described within this paper. xedar-fadd 1 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey physical association physical association This interaction was only detected in 293T cells treated with ectodysplasin-A2 (EDA-A2) as described within this paper.