IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. Cell (0092-8674) 2004 imex curation Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. pull down pull down anti tag western anti tag western blot anti tag western Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu Accepted 2009-MAY-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2004 davet Only protein-protein interactions imex curation A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. Cell (0092-8674) 2004 imex curation Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. pull down pull down western blot western blot Immuno blot Immuno blot Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu Accepted 2009-MAY-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2004 davet Only protein-protein interactions imex curation A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. Cell (0092-8674) 2004 imex curation Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu Accepted 2009-MAY-7 by DAVET. Cell (0092-8674) 2004 davet Only protein-protein interactions imex curation A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. A role for Drosophila IAP1-mediated caspase inhibition in Rac-dependent cell migration. Cell (0092-8674) 2004 imex curation Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu 27-Oct-2007: Contacted by JYOTI. davet Only protein-protein interactions drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Geisbrecht ER., Montell DJ. Apoptosis - Interactions involving proteins with a function related to apoptosis dmontell@jhmi.edu Accepted 2009-MAY-7 by DAVET. 27-Oct-2007: Contacted by JYOTI. Cell (0092-8674) 2004 davet Only protein-protein interactions imex curation prof_drome Profilin chic chi CG9553 Protein chickadee protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNGVTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDYLITCGY 6E2942C12A81ADEA diap1_drome Death-associated inhibitor of apoptosis 1 Diap1 Apoptosis 1 inhibitor E3 ubiquitin-protein ligase th Iap1 Inhibitor of apoptosis 1 Protein thread th CG12284 RING-type E3 ubiquitin transferase Diap1 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MASVVADLPSYGPIAFDQVDNNTNATQLFKNNINKTRMNDLNREETRLKTFTDWPLDWLDKRQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNCPLLRRRTTNNVPINAEALDRILPPISYDICGANDSTLEMREHAYAEGVIPMSQLIQSIGMNAVNAAGSVTGTAAPQPRVTVATHASTATQATGDVQPETCRPSAASGNYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEEKEESSSIGGVAVASTQASEEEQQTSLSSEEAVSGDVAPSVAPTAATRIFNKIVEATAVATPSTNSSGSTSIPEEKLCKICYGAEYNTAFLPCGHVVACAKCASSVTKCPLCRKPFTDVMRVYFS 24CA8BC13F5DEF31 rac1_drome Ras-related protein Rac1 Rac1 RacA CG2248 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDAKPINLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLRDDKNTIEKLRDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRSVLCPVLQPKSKRKCALL F910B54BDBD8AFA3 diap1-rac 1 7 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40792:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 17:20:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 18:23:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' P40792:p.Thr17Asn mutation mutation certain certain sequence position certain certain certain sequence position certain T N Wed May 02 19:43:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17asn' Tue Jun 30 17:07:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Asn' 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association V12 mutant constitutively active 6F GST-DIAP1 pulled down both the GTP or GDP bound form of Rac (Figure 6F), whereas GST alone did not. diap1-prof 3 5 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 6B rac1-prof-1 3 5 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P40792:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 18:10:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 18:56:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' P40792:p.Thr17Asn mutation mutation certain certain sequence position certain certain certain sequence position certain T N Wed May 02 19:26:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr17asn' Tue Jun 30 16:07:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr17Asn' ecoli Escherichia coli (strain K12) physical association physical association 6B diap1-prof-1 2 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6E rac1-profilin 4 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association 6D rac1-profilin-1 4 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association 6C